NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS24641.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24641.1 Public Mus musculus 11 Zfp354b 23 108 98 CCDS HistoryNCBI Gene:27274Re-query CCDS DB by CCDS ID:24641.1See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24641.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000109124.9 ENSMUSP00000104752.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109124.9Link to Ensembl Protein Viewer:ENSMUSP00000104752.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000109124Re-query CCDS DB by Protein ID:ENSMUSP00000104752
Original member Current member EBI ENSMUST00000164280.1 ENSMUSP00000127671.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164280.1Link to Ensembl Protein Viewer:ENSMUSP00000127671.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000164280Re-query CCDS DB by Protein ID:ENSMUSP00000127671
Original member Current member NCBI NM_013744.3 NP_038772.1 Accepted alive Link to Nucleotide Sequence:NM_013744.3Link to Protein Sequence:NP_038772.1Re-query CCDS DB by Nucleotide ID:NM_013744Re-query CCDS DB by Protein ID:NP_038772Link to BLAST:NP_038772.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038772.1 601 Q9QXT9 601 100% 0 0

Chromosomal Locations for CCDS 24641.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 50922291 50923840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 50928564 50928659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 50929377 50929503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 50930901 50930933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1806 nt):
ATGGCTCCAGAGCAAAGGGAAGGGAAGTCTCAGGTGTCGGTGACGTTTGAAGACGTGGCCGTGCTCTTTA
CC
CGGGATGAGTGGAAGAAGCTGGTTCCCTCTCAGAGAAGCCTGTACCGTGAGGTGATGCTGGAGAACTA
C
AGCAACCTGGCCTCGCTGGGATTCCCATTTACCAAACCAAAGATGATCTCCGTGTTGCAACAAGGAGAA
GAA
CCCTGGAAATCAGAGAAAGAAAGTCATGGATGCTCCCCTCTTGGATGTCACGGCAGTCTTCAAACCA
CA
AAATCAACTCAAACTAAAGAGTCATTGTTTCAGGAATTAAAGAGGAAACAACTCAAAAGGGATGAGGC
C
TGGGACTTCACGTCAGGAAAATCCTGCAGACCTGACAACAGTTTTAGAACACAGGATACAAATGAAAGC
TTA
GAAATAATTTCAATCAACCATACAAAAATTCTTACTATAGATAAAAGCCGTAAGAATTTTAAATTTG
GT
CCAAGCGTTGGCCTGAAGTCAATTGGTAAGCAAAAGATTGCAGGAGAAAAAACACAAAGAAATAGCCT
C
GAGGAAAATTCAACTTTACTTAGTCAACCAAAACTCAAGACAGTAGAGAAACGCTATAAATGTAGTACT
TGC
GAAAAAGCCTTCATTCACAACTCATCCCTTCGCAAACATCTGAAAAACCATACTGGAGAGAGACTAT
TT
CAGTGTAAAGACTGTTTGAAAGCTTTCAGCCAAAGTTCTGCCCTTATTCAACATCAAAGAACTCACAC
T
GGAGAGAAGCCCTATATATGTAAAGAGTGTGGAAAGGCCTTCAGCCATAGTGCATCCCTCTGCAAGCAC
CTA
AGAACTCATACTTTGGAAAAATCCTATACATGCAAAGAATGTGGAAAATCTTTTAGCAGAAGGTCTG
GC
CTTTTTTTGCACCAAAAAATCCATGCCCGAGAAAATCCTCATAAATATAACCCAGGAAGGAAGGCATC
C
ACGTCCCTTTCAGGATGCCAGAGAATTCATTCCAGAAAGAAGACCTACTTGTGCAACGAATGTGGCAAC
ACC
TTTAAGTCTAGCTCATCCCTTCGTTATCATCAGAGGATCCACACCGGAGAGAAACCTTTCAAGTGCA
GT
GAGTGTGGTAGGGCCTTCAGTCAGAGTGCATCACTTATTCAGCATGAAAGAATCCACACTGGAGAAAA
G
CCCTACAGATGCAGTGAGTGCGGGAAAGGCTTCACTTCCATCTCAAGACTCAATAGACACCGAATAATT
CAT
ACGGGAGAGAAGTTTTATAATTGCAATGAGTGTGGCAAAGCCTTAAGTTCCCATTCAACTCTTATTA
TT
CACGAAAGAATCCACACTGGAGAGAAACCGTGTAAATGTAAAGTTTGTGGGAAAGCCTTCCGACAAAG
T
TCAGCTCTGATCCAACATCAGAGAATGCACACTGGAGAAAGACCCTATAAATGCAATGAGTGCGGCAAG
ACC
TTCAGGTGTAACTCATCCCTAAGTAACCATCAGCGAACCCACACTGGAGAGAAGCCGTACCGATGTC
AG
GAATGCGGGATGTCATTTGGACAAAGTGCAGCTCTTATTCAGCACCGAAGGATTCACACTGGTGAGAA
A
CCCTTTAAATGTAACACGTGCGGGAAGAGTTTTAGACAAAGCTCCTCACTTATTGCCCATCAGAGGATT
CAC
ACTGGAGAGAAACCCTATGAGTGCAGTGCTTGTGGCAAGCTCTTCAGCCAGAGATCCTCCCTAACCA
AT
CACTATAGAATTCATATCGAAGAGGACGCCTTGAACATAGATTTGCATGAGTAA


Translation (601 aa):
MAPEQREGKSQVSVTFEDVAVLFTRDEWKKLVPSQRSLYREVMLENYSNLASLGFPFTKPKMISVLQQGE
E
PWKSEKESHGCSPL
GCHGSLQTTKSTQTKESLFQELKRKQLKRDEAWDFTSGKSCRPDNSFRTQDTNES
L
EIISINHTKILTIDKSRKNFKFGPSVGLKSIGKQKIAGEKTQRNSLEENSTLLSQPKLKTVEKRYKCST
C
EKAFIHNSSLRKHLKNHTGERLFQCKDCLKAFSQSSALIQHQRTHTGEKPYICKECGKAFSHSASLCKH
L
RTHTLEKSYTCKECGKSFSRRSGLFLHQKIHARENPHKYNPGRKASTSLSGCQRIHSRKKTYLCNECGN
T
FKSSSSLRYHQRIHTGEKPFKCSECGRAFSQSASLIQHERIHTGEKPYRCSECGKGFTSISRLNRHRII
H
TGEKFYNCNECGKALSSHSTLIIHERIHTGEKPCKCKVCGKAFRQSSALIQHQRMHTGERPYKCNECGK
T
FRCNSSLSNHQRTHTGEKPYRCQECGMSFGQSAALIQHRRIHTGEKPFKCNTCGKSFRQSSSLIAHQRI
H
TGEKPYECSACGKLFSQRSSLTNHYRIHIEEDALNIDLHE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser