NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS3545.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
3545.1 Public Homo sapiens 4 JCHAIN 22 109 92 CCDS HistoryNCBI Gene:3512Re-query CCDS DB by CCDS ID:3545.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 3545.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000254801.8 ENSP00000254801.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000254801.8Link to Ensembl Protein Viewer:ENSP00000254801.4Re-query CCDS DB by Nucleotide ID:ENST00000254801Re-query CCDS DB by Protein ID:ENSP00000254801
Original member Current member EBI ENST00000510437.5 ENSP00000426687.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000510437.5Link to Ensembl Protein Viewer:ENSP00000426687.1Re-query CCDS DB by Nucleotide ID:ENST00000510437Re-query CCDS DB by Protein ID:ENSP00000426687
Original member Current member EBI ENST00000543780.5 ENSP00000440066.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000543780.5Link to Ensembl Protein Viewer:ENSP00000440066.2Re-query CCDS DB by Nucleotide ID:ENST00000543780Re-query CCDS DB by Protein ID:ENSP00000440066
Original member NCBI NM_144646.3 NP_653247.1 Updated not alive Link to Nucleotide Sequence:NM_144646.3Link to Protein Sequence:NP_653247.1Re-query CCDS DB by Nucleotide ID:NM_144646Re-query CCDS DB by Protein ID:NP_653247
Current member NCBI NM_144646.4 NP_653247.1 Accepted alive Link to Nucleotide Sequence:NM_144646.4Link to Protein Sequence:NP_653247.1Re-query CCDS DB by Nucleotide ID:NM_144646Re-query CCDS DB by Protein ID:NP_653247Link to BLAST:NP_653247.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_653247.1 159 P01591 159 100% 0 0

Chromosomal Locations for CCDS 3545.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 70656329 70656539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70657211 70657291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70662092 70662215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70666427 70666490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (480 nt):
ATGAAGAACCATTTGCTTTTCTGGGGAGTCCTGGCGGTTTTTATTAAGGCTGTTCATGTGAAAGCCCAAG
AA
GATGAAAGGATTGTTCTTGTTGACAACAAATGTAAGTGTGCCCGGATTACTTCCAGGATCATCCGTTC
T
TCCGAAGATCCTAATGAGGACATTGTGGAGAGAAACATCCGAATTATTGTTCCTCTGAACAACAGGGAG
AAT
ATCTCTGATCCCACCTCACCATTGAGAACCAGATTTGTGTACCATTTGTCTGACCTCTGTAAAAAAT
GT
GATCCTACAGAAGTGGAGCTGGATAATCAGATAGTTACTGCTACCCAGAGCAATATCTGTGATGAAGA
C
AGTGCTACAGAGACCTGCTACACTTATGACAGAAACAAGTGCTACACAGCTGTGGTCCCACTCGTATAT
GGT
GGTGAGACCAAAATGGTGGAAACAGCCTTAACCCCAGATGCCTGCTATCCTGACTAA


Translation (159 aa):
MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDIVERNIRIIVPLNNRE
N
ISDPTSPLRTRFVYHLSD
LCKKCDPTEVELDNQIVTATQSNICDEDSATETCYTYDRNKCYTAVVPLVY
G
GETKMVETALTPDACYPD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser