NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS13819.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13819.1 Public Homo sapiens 22 MIF 22 109 92 CCDS HistoryNCBI Gene:4282Re-query CCDS DB by CCDS ID:13819.1See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13819.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000215754.7 ENSP00000215754.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000215754.7Link to Ensembl Protein Viewer:ENSP00000215754.7Re-query CCDS DB by Nucleotide ID:ENST00000215754Re-query CCDS DB by Protein ID:ENSP00000215754
Original member NCBI NM_002415.1 NP_002406.1 Updated not alive Link to Nucleotide Sequence:NM_002415.1Link to Protein Sequence:NP_002406.1Re-query CCDS DB by Nucleotide ID:NM_002415Re-query CCDS DB by Protein ID:NP_002406
Current member NCBI NM_002415.2 NP_002406.1 Accepted alive Link to Nucleotide Sequence:NM_002415.2Link to Protein Sequence:NP_002406.1Re-query CCDS DB by Nucleotide ID:NM_002415Re-query CCDS DB by Protein ID:NP_002406Link to BLAST:NP_002406.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002406.1 115 P14174 115 100% 0 0

Chromosomal Locations for CCDS 13819.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 23894475 23894582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 23894772 23894944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 23895040 23895106 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (348 nt):
ATGCCGATGTTCATCGTAAACACCAACGTGCCCCGCGCCTCCGTGCCGGACGGGTTCCTCTCCGAGCTCA
CC
CAGCAGCTGGCGCAGGCCACCGGCAAGCCCCCCCAGTACATCGCGGTGCACGTGGTCCCGGACCAGCT
C
ATGGCCTTCGGCGGCTCCAGCGAGCCGTGCGCGCTCTGCAGCCTGCACAGCATCGGCAAGATCGGCGGC
GCG
CAGAACCGCTCCTACAGCAAGCTGCTGTGCGGCCTGCTGGCCGAGCGCCTGCGCATCAGCCCGGACA
G
G
GTCTACATCAACTATTACGACATGAACGCGGCCAATGTGGGCTGGAACAACTCCACCTTCGCCTAA


Translation (115 aa):
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGG
A
QNRSYSKLLCGLLAERLRISPD
RVYINYYDMNAANVGWNNSTFA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser