NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS73375.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73375.1 Public Homo sapiens 11 MMP12 22 109 92 CCDS HistoryNCBI Gene:4321Re-query CCDS DB by CCDS ID:73375.1See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 73375.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000571244.2 ENSP00000458585.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000571244.2Link to Ensembl Protein Viewer:ENSP00000458585.1Re-query CCDS DB by Nucleotide ID:ENST00000571244Re-query CCDS DB by Protein ID:ENSP00000458585
Original member NCBI NM_002426.5 NP_002417.2 Updated not alive Link to Nucleotide Sequence:NM_002426.5Link to Protein Sequence:NP_002417.2Re-query CCDS DB by Nucleotide ID:NM_002426Re-query CCDS DB by Protein ID:NP_002417
Current member NCBI NM_002426.6 NP_002417.2 Accepted alive Link to Nucleotide Sequence:NM_002426.6Link to Protein Sequence:NP_002417.2Re-query CCDS DB by Nucleotide ID:NM_002426Re-query CCDS DB by Protein ID:NP_002417Link to BLAST:NP_002417.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002417.2 470 P39900 470 100% 0 0

Chromosomal Locations for CCDS 73375.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 102863100 102863200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102864146 102864252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102865776 102865935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102866315 102866448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102867270 102867393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102867908 102868069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102871594 102871719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102871804 102871952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102872865 102873112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 102874836 102874937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1413 nt):
ATGAAGTTTCTTCTAATACTGCTCCTGCAGGCCACTGCTTCTGGAGCTCTTCCCCTGAACAGCTCTACAA
GC
CTGGAAAAAAATAATGTGCTATTTGGTGAAAGATACTTAGAAAAATTTTATGGCCTTGAGATAAACAA
A
CTTCCAGTGACAAAAATGAAATATAGTGGAAACTTAATGAAGGAAAAAATCCAAGAAATGCAGCACTTC
TTG
GGTCTGAAAGTGACCGGGCAACTGGACACATCTACCCTGGAGATGATGCACGCACCTCGATGTGGAG
TC
CCCGATGTCCATCATTTCAGGGAAATGCCAGGGGGGCCCGTATGGAGGAAACATTATATCACCTACAG
A
ATCAATAATTACACACCTGACATGAACCGTGAGGATGTTGACTACGCAATCCGGAAAGCTTTCCAAGTA
TGG
AGTAATGTTACCCCCTTGAAATTCAGCAAGATTAACACAGGCATGGCTGACATTTTGGTGGTTTTTG
CC
CGTGGAGCTCATGGAGACTTCCATGCTTTTGATGGCAAAGGTGGAATCCTAGCCCATGCTTTTGGACC
T
GGATCTGGCATTGGAGGGGATGCACATTTCGATGAGGACGAATTCTGGACTACACATTCAGGAGGCACA
AAC
TTGTTCCTCACTGCTGTTCACGAGATTGGCCATTCCTTAGGTCTTGGCCATTCTAGTGATCCAAAGG
CC
GTAATGTTCCCCACCTACAAATATGTTGACATCAACACATTTCGCCTCTCTGCTGATGACATACGTGG
C
ATTCAGTCCCTGTATGGAGACCCAAAAGAGAACCAACGCTTGCCAAATCCTGACAATTCAGAACCAGCT
CTC
TGTGACCCCAATTTGAGTTTTGATGCTGTCACTACCGTGGGAAATAAGATCTTTTTCTTCAAAGACA
G
G
TTCTTCTGGCTGAAGGTTTCTGAGAGACCAAAGACCAGTGTTAATTTAATTTCTTCCTTATGGCCAAC
C
TTGCCATCTGGCATTGAAGCTGCTTATGAAATTGAAGCCAGAAATCAAGTTTTTCTTTTTAAAGATGAC
AAA
TACTGGTTAATTAGCAATTTAAGACCAGAGCCAAATTATCCCAAGAGCATACATTCTTTTGGTTTTC
CT
AACTTTGTGAAAAAAATTGATGCAGCTGTTTTTAACCCACGTTTTTATAGGACCTACTTCTTTGTAGA
T
AACCAGTATTGGAGGTATGATGAAAGGAGACAGATGATGGACCCTGGTTATCCCAAACTGATTACCAAG
AAC
TTCCAAGGAATCGGGCCTAAAATTGATGCAGTCTTCTACTCTAAAAACAAATACTACTATTTCTTCC
AA
GGATCTAACCAATTTGAATATGACTTCCTACTCCAACGTATCACCAAAACACTGAAAAGCAATAGCTG
G
TTTGGTTGTTAG


Translation (470 aa):
MKFLLILLLQATASGALPLNSSTSLEKNNVLFGERYLEKFYGLEINKLPVTKMKYSGNLMKEKIQEMQHF
L
GLKVTGQLDTSTLEMMHAPRCGVPDVHHFREMPGGPVWRKHYITY
RINNYTPDMNREDVDYAIRKAFQV
W
SNVTPLKFSKINTGMADILVVFARG
AHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGT
N
LFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLY
GDPKENQRLPNPDNSEPA
L
CDPNLSFDAVTTVGNKIFFFKD
RFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDD
K
YWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYW
RYDERRQMMDPGYPKLITK
N
FQGIGPKIDAVFYSKN
KYYYFFQGSNQFEYDFLLQRITKTLKSNSWFGC



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser