NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS40324.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
40324.1 Public Mus musculus 8 Mtmr7 23 108 98 CCDS HistoryNCBI Gene:54384Re-query CCDS DB by CCDS ID:40324.1See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 40324.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000048898.16 ENSMUSP00000043851.10 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048898.16Link to Ensembl Protein Viewer:ENSMUSP00000043851.10Re-query CCDS DB by Nucleotide ID:ENSMUST00000048898Re-query CCDS DB by Protein ID:ENSMUSP00000043851
Original member Current member NCBI NM_001040699.1 NP_001035789.1 Accepted alive Link to Nucleotide Sequence:NM_001040699.1Link to Protein Sequence:NP_001035789.1Re-query CCDS DB by Nucleotide ID:NM_001040699Re-query CCDS DB by Protein ID:NP_001035789Link to BLAST:NP_001035789.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001035789.1 660 Q9Z2C9 660 100% 0 0

Chromosomal Locations for CCDS 40324.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 40551551 40551913 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40554271 40554397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40555776 40555916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40558156 40558356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40560857 40560906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40562570 40562695 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40563960 40564069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40581414 40581546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40587048 40587182 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40590410 40590538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40597283 40597440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40606759 40606921 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40608894 40609016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 40634698 40634721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1983 nt):
ATGGAGCACATCCGCACGCCCAAGGTTGAAAACGTGCGCTTGGTAGACAGAGTGTCTTGTAAAAAGGCAG
CG
CTGGGAACTTTGTATCTGACGGCCACTCACGTCATATTCGTGGAAAATGCACCTGACACAAGAAAAGA
A
ACCTGGATTCTGCACAGTCAGATCTCCACCATTGAAAAGCAGGCGACAACAGCTACGGGCTGCCCTCTG
CTT
ATTCGCTGCAAGAACTTCCAGATCGTACAACTTGTCATTCCACAGGAGAGAGACTGCCACGACGTGT
AC
ATCTCTCTGATACGCCTTGCACGGCCAGTGAAGTACGAGGAGCTATACTGCTTTTCCTTCAACCCCAA
G
CTGGATAAGGAAGAACGGGAGCAGGGCTGGTTGCTGGTTGACCTTAGTGAAGAATACAAGCGAATGGGC
CTC
CCTGATAATTATTGGCAGCTCAGCGATGTGAATAGAGACTACAGAGTTTGTGACTCTTACCCCACGG
AA
CTGTACGTCCCCAGATCGGCCACGGCACACATCATCGTGGGCAGCTCCAAGTTCCGGAGCAGACGGCG
A
TTTCCTGCCCTTTCCTACTACTGTAAAGACAGCCATGCCTCCATCTGCAGGAGCAGCCAGCCCCTTTCC
GGC
TTCAGCGCTCGGTGCCTGGAGGATGAGCAGATGCTCCAAGCCATCAGGAAAGCCAATCCTGGAAGTG
AC
TTCATTTATGTCGTGGACACAAGGCCTAAACTTAATGCGATGGCAAATCGTGCTGCAGGGAAAGGCTA
T
GAGAATGAAGACAATTATTCCAATATCAAGTTTCAGTTTATCGGCATAGAGAACATCCACGTCATGAGG
AAC
AGTCTTCAGAAAATGCTGGAAGTGTGTGAACTTAAATCTCCCTCTATGAGTGATTTCCTGTGGGGAC
TG
GAGAACTCAGGCTGGCTGAGGCACATCAAAGCCATCATGGATGCAGGGATCTTCATTGCAAAGGCAGT
T
TCAGAGGAAGGGGCAAGTGTGCTTGTTCACTGTTCTGACGGCTGGGACAGAACGGCCCAGGTGTGCTCG
GTG
GCTAGCCTGCTGCTGGACCCTTACTACCGGACTCTGAAAGGATTCATGGTATTAATTGAAAAGGACT
GG
ATTTCCTTCGGACATAAATTTAATCATAGATATGGCAACTTAGATGGTGACCCAAAAGAAATCTCTCC
A
GTAATCGACCAGTTCATTGAGTGTGTCTGGCAGCTAACGGAACAGTTCCCTTGCGCCTTTGAGTTCAAC
GAG
AGGTTTCTGACTCACATTCAGCATCATGTTTATTCCTGCCAGTTTGGGAACTTCCTGTGTAATAGCC
AG
AAGGAGAGGCGAGAACTCAAGATTCAAGAAAGAACCTACTCTTTGTGGTCCAACCTGTGGAAGAATCG
A
GCTGACTACCTCAATCCTCTGTTTAGAGCTGACCACAGTCAGACCCAGGGGAGCCTTCATCTGCCTACA
GCT
CCATGCAACTTCACCTATAAGTTTTGGAATGGGATGTATAACCGCTTTGAAAAGGGGTTGCAGCCTC
GA
CAGTCTGTTACAGATTACCTCATGGCTGTGAAGGAGGAGTCCCAGCAGCTGGAGGAAGAACTGGAGTC
C
CTAGAAGAAAGGCTGGAAAAAATTCAGAAAGTCCACTTACATGGTACCAAAGTGAAGAGTAAGCAAAGT
GAG
CCCAGCAAACACTCGGGGTTCTCTACCTCAGACCACAGCACAGCCAACACCCCTCAGGATTACAGTG
GG
AACAGCAAGTCCTTCCCATCCAGGAGCCCGTCCCAGGGTGATGAAGATTCTGCTCTGATTCTAACCCA
A
GACAATTTAAAAAGCTCAGACCCCGACCTCTCAGTGAATAGTGATCAAGAGTCTGGGGTGGAGGATTTG
AGC
TGTCGATCTCCCAGTGGTGGTGAGCATGCACCCAGCGAAGACAGTGGCAAGGACCGGGACTCGGACG
AA
GCTGTGTTTCTCACTGCCTAA


Translation (660 aa):
MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEKQATTATGCPL
L
IRCKNFQIVQLVIPQERDCHDVYISLIRLARP
VKYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMG
L
PDNYWQLSDVNRDYR
VCDSYPTELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSHASICRSSQPLS
G
FSARCLEDEQMLQAIRKANPGSDFIYVVDTRPK
LNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMR
N
SLQKMLE
VCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCS
V
ASLLLDPYYRTLKGFM
VLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLTEQFPCAFEFN
E
RFLTHIQHHVYSCQFGNFLCNSQKERREL
KIQERTYSLWSNLWKNRADYLNPLFRADHSQTQGSLHLPT
A
PCNFTY
KFWNGMYNRFEKGLQPRQSVTDYLMAVKEESQQLEEELESLEERLEKIQKVHLHGTKVKSKQS
E
PSKHSGFSTSDHSTANTPQDYSGNSKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSVNSDQESGVEDL
S
CRSPSGGEHAPSEDSGKDRDSDEAVFLTA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser