NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29594.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29594.1 Public Mus musculus 19 Ms4a15 23 108 98 CCDS HistoryNCBI Gene:545279Re-query CCDS DB by CCDS ID:29594.1See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29594.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000087923.3 ENSMUSP00000085234.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000087923.3Link to Ensembl Protein Viewer:ENSMUSP00000085234.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000087923Re-query CCDS DB by Protein ID:ENSMUSP00000085234
Original member Current member NCBI NM_001034898.2 NP_001030070.1 Accepted alive Link to Nucleotide Sequence:NM_001034898.2Link to Protein Sequence:NP_001030070.1Re-query CCDS DB by Nucleotide ID:NM_001034898Re-query CCDS DB by Protein ID:NP_001030070Link to BLAST:NP_001030070.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001030070.1 245 Q3UPL6 245 100% 0 0

Chromosomal Locations for CCDS 29594.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 10979209 10979325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10980099 10980212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10980570 10980662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10981293 10981349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10983173 10983295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10984670 10984844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 10993119 10993177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (738 nt):
ATGTGGGAGCGCAGAGGCAGAGGGGAGTCAGCAGCCGGTACAGCAGCCGTGGCAAGCCGCAACGCCAGCG
GC
CTCCGCCCACCTCCAGCCATTCTGCCCACCTCCATGTGCCAGCCTCCAGGGATCATGCAGTTCGAAGA
G
TCACAGCTGGGGGCGCAGGCGCCCAGAGCTACTCAACCACCTGATCTTAGACCAATGGAGACGTTCTTG
ACC
GGAGAACCCAAAGCTTTAGGGACGGTGCAGATCCTGATCGGTCTCATCCACCTTGGCTTCGGCAGCG
TC
CTGCTTATGGTTCGGCGAGGCCACCTGGGGATGCTCTTCATCGAAGGTGGCGTCCCCTTCTGGGGAGG
A
GCTTGTTTTATCATCTCTGGGTCCCTCTCCGTAGCAGCTGAGAGGAACCACACCAGTTGCCTGTTGAAG
AGC
AGTCTGGGAACCAACATCCTCAGTGCCATGGCAGCCTTCGCGGGGACAGCCATTCTTCTCATGGACT
TT
GGTGTCACTAACTGGGATGTGGGCAGGGGCTACCTTGCCGTGTTGACCATCTTCACCATCCTGGAGTT
C
TTCATCGCTGTCATTGCCACCCACTTTGGGTGCCAAGCCACCCGTGCTCAAACTAACGCATCTGTGATT
TTC
CTACCCAATGCCTTTGGCACGGATTTCAACATCCCCAGCCCAGCAGTCTCTCCACCTCCTGCCTATG
AC
AACGTGGCATATATGCCCAAGGAGTCATCAGAATAG


Translation (245 aa):
MWERRGRGESAAGTAAVASRNASGLRPPPAILPTSMCQPPGIMQFEESQLGAQAPRATQPPDLRPMETFL
T
GEPKALG
TVQILIGLIHLGFGSVLLMVRRGHLGMLFIEGGVPFWGGACFIISGSLSVAAERNHTSCLLK
S
SLGTNILSAMAAFAGTAILLMDFGVTNW
DVGRGYLAVLTIFTILEFFIAVIATHFGCQATRAQTNASVI
F
LPNAFGTDFNIPSPAVSPPPAYDNVAYMPKESSE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser