NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27211.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27211.1 Public Mus musculus 14 Extl3 23 108 98 CCDS HistoryNCBI Gene:54616Re-query CCDS DB by CCDS ID:27211.1See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27211.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000022550.7 ENSMUSP00000022550.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022550.7Link to Ensembl Protein Viewer:ENSMUSP00000022550.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000022550Re-query CCDS DB by Protein ID:ENSMUSP00000022550
Original member Current member EBI ENSMUST00000225633.1 ENSMUSP00000153547.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000225633.1Link to Ensembl Protein Viewer:ENSMUSP00000153547.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000225633Re-query CCDS DB by Protein ID:ENSMUSP00000153547
Original member Current member NCBI NM_001360385.1 NP_001347314.1 Accepted alive Link to Nucleotide Sequence:NM_001360385.1Link to Protein Sequence:NP_001347314.1Re-query CCDS DB by Nucleotide ID:NM_001360385Re-query CCDS DB by Protein ID:NP_001347314Link to BLAST:NP_001347314.1
Original member Current member NCBI NM_018788.3 NP_061258.2 Accepted alive Link to Nucleotide Sequence:NM_018788.3Link to Protein Sequence:NP_061258.2Re-query CCDS DB by Nucleotide ID:NM_018788Re-query CCDS DB by Protein ID:NP_061258Link to BLAST:NP_061258.2

Chromosomal Locations for CCDS 27211.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 14 (NC_000080.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 65054613 65054822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65056831 65056959 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65058985 65059129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65066683 65066810 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 65075584 65077731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2760 nt):
ATGACAGGCTATACCATGTTGCGGAATGGGGGAGTGGGGAACGGTGGTCAGACCTGTATGCTGCGCTGGT
CC
AATCGCATCCGGCTGACATGGCTGAGTTTCACGCTGTTCATCATCCTCGTCTTCTTCCCCCTCATTGC
T
CACTATTACCTCACCACTCTGGACGAGGCAGACGAGGCTGGCAAGCGCATCTTCGGCCCTCGGGCTGGC
AGT
GAGCTCTGTGAGGTAAAGCACGTCCTCGATCTCTGTCGGATTCGTGAGTCTGTGAGCGAAGAGCTTC
TA
CAGCTCGAAGCCAAGCGGCAGGAGCTGAACAGCGAGATTGCCAAGCTGAACCTCAAGATTGAAGCCTG
T
AAGAAGAGCATAGAGAATGCCAAGCAGGACCTGCTGCAGCTCAAGAATGTCATTAGCCAGACAGAGCAC
TCC
TACAAGGAGCTGATGGCCCAGAACCAGCCCAAACTGTCCCTGCCCATCCGACTGCTCCCCGAGAAGG
AC
GATGCCGGCCTTCCACCCCCCAAGGTCACTCGGGGTTGCCGCCTTCACAACTGCTTTGATTACTCTCG
T
TGTCCTCTGACGTCTGGCTTTCCCGTCTACGTCTATGACAGTGACCAGTTTGCCTTTGGGAGCTACCTG
GAC
CCTTTGGTCAAGCAGGCTTTTCAGGCTACAGTGAGAGCCAACGTTTATGTTACAGAAAATGCGGCCA
TC
GCCTGCCTGTATGTGGTGTTAGTGGGAGAAATGCAAGAGCCCACTGTGCTGCGGCCTGCCGACCTTGA
A
AAGCAGCTGTTTTCTCTGCCACACTGGAGGACAGATGGGCACAACCACGTCATTATCAACCTGTCCCGG
AAG
TCAGACACACAGAATCTACTGTACAACGTCAGTACAGGCCGGGCCATGGTGGCCCAGTCCACCTTCT
AT
GCTGCCCAGTACAGAGCTGGCTTTGACCTGGTCGTGTCACCCCTTGTCCATGCTATGTCTGAACCCAA
C
TTCATGGAAATCCCACCGCAGGTGCCAGTTAAGCGGAAATATCTCTTCACTTTCCAGGGCGAGAAGATC
GAG
TCTCTGAGATCTAGCCTTCAGGAGGCCCGTTCCTTCGAGGAAGAGATGGAGGGCGACCCTCCGGCCG
AC
TATGACGATCGCATCATTGCCACCCTAAAGGCCGTACAGGACAGCAAGCTGGATCAGGTGCTGGTAGA
A
TTCACTTGCAAAAACCAGCCGAAGCCCAGCCTGCCGACTGAGTGGGCACTGTGTGGGGAGCGGGAAGAC
CGC
CTGGAGTTACTGAAGCTCTCCACCTTCGCCCTCATCATCACTCCCGGGGACCCGCACCTGCTCATTT
CA
TCTGGGTGTGCCACGCGGCTCTTCGAGGCCCTGGAGGTGGGGGCCGTGCCGGTGGTGCTCGGGGAGCA
G
GTGCAGCTCCCGTACCACGACATGCTGCAGTGGAACGAGGCCGCCCTGGTGGTGCCCAAGCCTCGCGTC
ACA
GAGGTCCACTTCCTGTTACGAAGTCTTTCAGACAGTGATCTGTTGGCCATGAGGCGGCAAGGCCGCT
TT
CTCTGGGAGACCTACTTCTCCACCGCAGACAGTATTTTTAATACCGTGCTGGCCATGATTAGGACTCG
A
ATTCAGATCCCAGCTGCTCCCATCCGGGAAGAGGTAGCGGCTGAGATCCCCCATCGTTCAGGCAAAGCA
GCT
GGAACTGACCCCAACATGGCTGACAATGGGGACCTGGACCTGGGGCCGGTAGAGACAGAACCACCCT
AT
GCCTCACCTAAATACCTCCGCAATTTCACTCTGACTGTCACAGACTGTTACCGTGGCTGGAACTCTGC
C
CCGGGACCCTTCCATCTTTTTCCCCACACACCCTTTGATCCTGTGTTGCCCTCTGAGGCCAAATTCCTG
GGC
TCAGGGACTGGATTTCGGCCCATCGGTGGCGGGGCTGGGGGCTCTGGCAAGGAGTTCCAGGCAGCGC
TC
GGAGGCAATGTCCAGCGGGAGCAGTTCACAGTTGTGATGCTGACCTACGAGCGGGAGGAAGTGCTCAT
G
AACTCCCTGGAGAGACTCAACGGCCTCCCCTACCTGAACAAGGTAGTGGTGGTGTGGAACTCTCCCAAG
CTG
CCCTCGGAGGACCTTTTGTGGCCAGACATTGGTGTCCCCATCATGGTCGTCCGTACTGAGAAGAACA
GT
TTGAACAATCGGTTCTTGCCCTGGAATGAGATTGAGACAGAGGCCATACTGTCCATCGACGATGATGC
T
CACCTCCGCCATGATGAAATCATGTTTGGGTTTCGGGTGTGGAGAGAAGCACGTGATCGCATTGTGGGT
TTC
CCTGGCCGGTACCATGCGTGGGACATACCACACCAGTCCTGGCTCTACAATTCCAACTACTCCTGTG
AG
CTGTCCATGGTGCTGACGGGCGCTGCCTTCTTTCACAAGTATTATGCCTACCTGTATTCTTATGTGAT
G
CCCCAGGCCATCCGGGACATGGTGGACGAGTACATCAACTGTGAGGATATCGCCATGAACTTCCTTGTC
TCC
CACATCACACGGAAACCCCCCATCAAGGTGACATCAAGGTGGACTTTTCGATGCCCAGGGTGCCCTC
AG
GCCCTGTCCCATGATGACTCTCATTTTCACGAGCGGCACAAGTGTATCAACTTTTTTGTCAAGGTGTA
C
GGCTATATGCCTCTCTTGTACACACAGTTCAGGGTGGACTCCGTGCTCTTCAAGACCCGCCTGCCCCAT
GAC
AAGACCAAGTGCTTCAAGTTCATCTAG


Translation (919 aa):
MTGYTMLRNGGVGNGGQTCMLRWSNRIRLTWLSFTLFIILVFFPLIAHYYLTTLDEADEAGKRIFGPRAG
S
ELCEVKHVLDLCRIRESVSEELLQLEAKRQELNSEIAKLNLKIEACKKSIENAKQDLLQLKNVISQTEH
S
YKELMAQNQPKLSLPIRLLPEKDDAGLPPPKVTRGCRLHNCFDYSRCPLTSGFPVYVYDSDQFAFGSYL
D
PLVKQAFQATVRANVYVTENAAIACLYVVLVGEMQEPTVLRPADLEKQLFSLPHWRTDGHNHVIINLSR
K
SDTQNLLYNVSTGRAMVAQSTFYAAQYRAGFDLVVSPLVHAMSEPNFMEIPPQVPVKRKYLFTFQGEKI
E
SLRSSLQEARSFEEEMEGDPPADYDDRIIATLKAVQDSKLDQVLVEFTCKNQPKPSLPTEWALCGERED
R
LELLKLSTFALIITPGDPHLLISSGCATRLFEALEVGAVPVVLGEQVQLPYHDMLQWNEAALVVPKPRV
T
EVHFLLRSLSDSDLLAMRRQGRFLWETYFSTADSIFNTVLAMIRTRIQIPAAPIREEVAAEIPHRSGKA
A
GTDPNMADNGDLDLGPVETEPPYASPKYLRNFTLTVTDCYRGWNSAPGPFHLFPHTPFDPVLPSEAKFL
G
SGTGFRPIGGGAGGSGKEFQAALGGNVQREQFTVVMLTYEREEVLMNSLERLNGLPYLNKVVVVWNSPK
L
PSEDLLWPDIGVPIM
VVRTEKNSLNNRFLPWNEIETEAILSIDDDAHLRHDEIMFGFRVWREARDRIVG
F
PGRYHAWDIPHQSWLYNSNYSCELSMVLTGAAFFHK
YYAYLYSYVMPQAIRDMVDEYINCEDIAMNFLV
S
HITRKPPIK
VTSRWTFRCPGCPQALSHDDSHFHERHKCINFFVKVYGYMPLLYTQFRVDSVLFKTRLPH
D
KTKCFKFI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser