NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27847.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27847.1 Public Mus musculus 15 Tamalin 23 108 98 CCDS HistoryNCBI Gene:56149Re-query CCDS DB by CCDS ID:27847.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27847.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000000543.5 ENSMUSP00000000543.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000543.5Link to Ensembl Protein Viewer:ENSMUSP00000000543.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000000543Re-query CCDS DB by Protein ID:ENSMUSP00000000543
Original member Current member NCBI NM_019518.3 NP_062391.3 Accepted alive Link to Nucleotide Sequence:NM_019518.3Link to Protein Sequence:NP_062391.3Re-query CCDS DB by Nucleotide ID:NM_019518Re-query CCDS DB by Protein ID:NP_062391Link to BLAST:NP_062391.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_062391.3 392 Q9JJA9 392 100% 0 0

Chromosomal Locations for CCDS 27847.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 101224302 101224544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101226914 101226963 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101228832 101228886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101228991 101229093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101230534 101230627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101230725 101230791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101230985 101231051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 101231517 101232016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1179 nt):
ATGACCCTCCGCCGACTCAGGAAGCTGCAGCAGAAGGAGGAGGCGACTGCCGCGCCGGACCCCGCTGGCC
GG
GCTCCCGACTCCGAAGCCGCTCGCGCCGCCCCGCTACCCTCCGGCCCTCCGGCTGCCGCCGCTCCGCC
C
GGAGCCCCCGGGGAGGAGCTGTACGCAGCACTGGAGGACTATCACCCTGCCGAGCTGTACCGCGCGCTC
GCC
GTGTCCGGGGGTACCCTGCCTCGCCGAAAGGGCTCAGGATTCCGTTGGAAGAATTTCACTCAGAGTC
CT
GAACAGCAACGGAAGGTTCTAACTTTGGAGAAAGGGGACAACCAGACCTTTGGCTTCGAGATCCAGAC
A
TATGGCCTTCACCACCGAGAGGAGCAGCGTGTAGAGATGGTGACCTTCGTCTGCCGAGTTCATGAATCC
AGC
CCTGCCCAGCTGGCTGGGCTCACGCCAGGGGACACTATTGCCAGCGTCAACGGTCTCAACGTGGAAG
GC
ATCCGGCACCGGGAGATTGTCGATATCATCAAGGCGTCTGGCAACGTTCTCAGGCTGGAAACTCTGTA
C
GGGACGTCCATTCGGAAGGCAGAACTGGAGGCGCGCCTGCAGTACCTTAAGCAAACCCTGTACGAGAAG
TGG
GGAGAATACAGGTCACTTATGGTACAGGAGCAGCGGCTAGTACATGGCCTGGTGGTGAAAGACCCAA
GC
ATCTATGACACACTGGAGTCCGTGCGCTCCTGCCTCTACGGCGCAGGCTTGCTTCCCGGGTCGCTGCC
C
TTTGGGCCTCTGCTCGCCGCGCCTGGGAGTGCCCGCGGGGGTGCGCGGCGGGCCAAAGGGGACACAGAC
GAC
GCCGTGTACCACACGTGCTTCTTTGGGGGCGCCGAGCCGCAGGCACTGCCACCCCCGCCACCCCCCG
CG
CGCGCGTTAGGCCCGAGCTCCGCGGAGACCCCCGCGTCCGTGCTGTTTCCCGCACCTCGCTCCACGCT
C
AGCCGCAGCGCCAGTGTGCGGTGCGCGGGCCCGGGCGGCGGCGGGGGCGCGCCGGGCGCACTCTGGACT
GAG
GCCCGCGAGCAGGCCCTGTGTGGCGCCGGCCTACGCAAGACCAAGTACCGCAGCTTCCGCAGACGGC
TG
CTCAAGTTCATCCCCGGACTCAACCGCTCCCTGGAGGAAGAGGAGAGCCAGCTGTAG


Translation (392 aa):
MTLRRLRKLQQKEEATAAPDPAGRAPDSEAARAAPLPSGPPAAAAPPGAPGEELYAALEDYHPAELYRAL
A
VSGGTLPRRK
GSGFRWKNFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFVCRVHES
S
PAQLAGLTP
GDTIASVNGLNVEGIRHREIVDIIKASGNVLRLETLYGTSIRKAELEARLQYLKQTLYEK
W
GEYRSLMVQEQRLVH
GLVVKDPSIYDTLESVRSCLYGAGLLPGSLPFGPLLAAPGSARGGARRAKGDTD
D
AVYHTCFFGGAEPQALPPPPPPARALGPSSAETPASVLFPAPRSTLSRSASVRCAGPGGGGGAPGALWT
E
AREQALCGAGLRKTKYRSFRRRLLKFIPGLNRSLEEEESQL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser