NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29599.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29599.1 Public Mus musculus 19 Ms4a4c 23 108 98 CCDS HistoryNCBI Gene:64380Re-query CCDS DB by CCDS ID:29599.1See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29599.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000072729.9 ENSMUSP00000072512.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000072729.9Link to Ensembl Protein Viewer:ENSMUSP00000072512.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000072729Re-query CCDS DB by Protein ID:ENSMUSP00000072512
Original member Current member NCBI NM_029499.3 NP_083775.1 Accepted alive Link to Nucleotide Sequence:NM_029499.3Link to Protein Sequence:NP_083775.1Re-query CCDS DB by Nucleotide ID:NM_029499Re-query CCDS DB by Protein ID:NP_083775Link to BLAST:NP_083775.1

Chromosomal Locations for CCDS 29599.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 11414817 11414951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11416329 11416448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11417643 11417699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11418993 11419118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11421258 11421359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 11426196 11426336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (681 nt):
ATGCAAGGACAGGAACAGACCACCATGGCAGTGGTTCCTGGAGGTGCTCCACCTTCAGAGAATTCTGTTA
TG
AAATCACAAATGTGGAACGAGAACAAGGAGAAATTCTTGAAGGGGGAACCCAAAGTCCTTGGGGTTGT
A
CAAGTTATGATTGCTCTCATAAACCTCAGCTTCGGAATAATAATTTTGGCAAATCTATCTTCTGAACCA
CTC
ATTTCTGTGGTCTTAATGGCTCCAATTTGGGGACCAATAATGTTCATTGTCTCAGGATCCCTGTCAA
TT
GCAGCAGGAGTGAAACCTACAAAAAGCCTGATCATCAGCAGTCTAACTCTGAACACTATCACCTCTGT
G
TTGGCTGCAACTGCAAGCATAATGGGTGTAGTCAGTGTGGCTGTGGGTTCACAGTTTCCGTTTCGGTAT
AAT
TATACAATCACCAAGGGTTTGGATATTTTGATGTTAATTTTAAATATGCTAGAATTCTGCATTGCTG
TG
TCCATCTCTGCTTTTGGATGTAAAGCTTCCTGTTGTAACTCCAGCGAGGTTCTTGTAGTGCTACCATC
A
AATCCTGCTGTGACTGTGATGGCACCCCCTGTGACGCTTCAACCATTGCCACCATCAGAACACCAAGGG
AAA
AATGTTCCAGAAAATGTATATAAGAACCACTCAGAAGAAATAGTCTAA


Translation (226 aa):
MQGQEQTTMAVVPGGAPPSENSVMKSQMWNENKEKFLKGEPKVLGVVQVMIALINLSFGIIILANLSSEP
L
ISVVLMAPIWGPIM
FIVSGSLSIAAGVKPTKSLIISSLTLNTITSVLAATASIMGVVSVAVGSQFPFRY
N
YTITK
GLDILMLILNMLEFCIAVSISAFGCKASCCNSSEVLVVLPSNPAVTVMAPPVTLQPLPPSEHQG
K
NVPENVYKNHSEEIV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser