NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS18225.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18225.1 Public Mus musculus 4 Inip 23 108 98 CCDS HistoryNCBI Gene:66209Re-query CCDS DB by CCDS ID:18225.1See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18225.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000095063.10 ENSMUSP00000092673.4 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000095063.10Link to Ensembl Protein Viewer:ENSMUSP00000092673.4Re-query CCDS DB by Nucleotide ID:ENSMUST00000095063Re-query CCDS DB by Protein ID:ENSMUSP00000092673
Original member Current member NCBI NM_001013577.1 NP_001013595.1 Accepted alive Link to Nucleotide Sequence:NM_001013577.1Link to Protein Sequence:NP_001013595.1Re-query CCDS DB by Nucleotide ID:NM_001013577Re-query CCDS DB by Protein ID:NP_001013595Link to BLAST:NP_001013595.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001013595.1 104 Q3TXT3-1 104 100% 0 0

Chromosomal Locations for CCDS 18225.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 59772364 59772459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59773916 59774006 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59775447 59775549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 59782254 59782278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (315 nt):
ATGGCAGCAAATCCTTCAGGACAAGGTTTTCAAAATAAAAATAGAGTTGCAATTTTGGCTGAACTGGACA
AA
GAGAAAAGAAAACTACTTATGCAGAACCAATCTTCAACAAGCCACCCTGGAGCTAGCATCTCGCTCTC
C
AGACCCTCTCTTACCAAGGACTTCCGGGACCATGCTGAGCAGCAGCACATCGCTGCCCAGCAGAAGGCA
GCT
TTGCAGCATGCTCACGCACATTCCTCTGGCTACTTCATAACTCAAGACTCTGCCTTTGGGAATCTGA
TT
CTCCCTGTTTTACCTCGCCTTGACCCCGAATGA


Translation (104 aa):
MAANPSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTSHPGASISLSRPSLTKDFRDHAEQQHIAAQQKA
A
LQ
HAHAHSSGYFITQDSAFGNLILPVLPRLDPE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser