NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27491.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27491.1 Public Mus musculus 15 Fbxo32 23 108 98 CCDS HistoryNCBI Gene:67731Re-query CCDS DB by CCDS ID:27491.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27491.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000022986.7 ENSMUSP00000022986.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022986.7Link to Ensembl Protein Viewer:ENSMUSP00000022986.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000022986Re-query CCDS DB by Protein ID:ENSMUSP00000022986
Original member Current member NCBI NM_026346.3 NP_080622.1 Accepted alive Link to Nucleotide Sequence:NM_026346.3Link to Protein Sequence:NP_080622.1Re-query CCDS DB by Nucleotide ID:NM_026346Re-query CCDS DB by Protein ID:NP_080622Link to BLAST:NP_080622.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080622.1 355 Q9CPU7 355 100% 0 0

Chromosomal Locations for CCDS 27491.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 58181466 58181555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58182835 58182978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58184082 58184264 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58191285 58191469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58192271 58192364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58205213 58205305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58206199 58206248 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58207955 58208067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58214496 58214611 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1068 nt):
ATGCCGTTCCTTGGGCAGGACTGGCGGTCCCCGGGCCAGAGCTGGGTGAAGACGGCGGACGGCTGGAAGC
GC
TTCTTGGATGAGAAAAGCGGCAGCTTCGTGAGCGACCTCAGCAGTTACTGCAACAAGGAGGTATACAG
T
AAGGAGAATCTGTTCAGCAGCCTGAACTACGACGTCGCAGCCAAGAAGAGAAAGAAAGACATTCAGAAC
AGC
AAAACCAAAACTCAGTACTTCCATCAAGAAAAGTGGATCTATGTTCACAAAGGAAGTACGAAGGAGC
GC
CATGGATACTGTACTTTGGGGGAAGCTTTCAACAGACTGGACTTCTCGACTGCCATCCTGGATTCCAG
A
AGATTCAACTACGTAGTAAGGCTGTTGGAGCTGATAGCAAAGTCACAGCTCACATCCCTGAGTGGCATC
GCC
CAAAAGAACTTCATGAACATTTTGGAAAAAGTGGTACTGAAAGTTCTTGAAGACCAGCAAAACATAA
GA
CTTATACGGGAACTTCTCCAGACTCTCTACACATCCTTATGCACACTGGTGCAGAGAGTCGGCAAGTC
T
GTGCTGGTGGGCAACATTAACATGTGGGTGTATCGGATGGAGACCATTCTACACTGGCAGCAGCAGCTG
AAT
AGCATCCAGATCAGCAGGCCTGCCTTCAAAGGCCTCACGATCACCGACCTGCCTGTGTGCTTACAAC
TG
AACATCATGCAGAGGCTGAGTGACGGGCGGGACCTGGTCAGCCTGGGCCAGGCAGCCCCAGACCTGCA
T
GTGCTCAGTGAGGACCGGCTACTGTGGAAGAGACTCTGCCAGTACCACTTCTCAGAGAGGCAGATTCGC
AAG
CGTTTGATCTTGTCTGACAAAGGGCAGCTGGATTGGAAGAAGATGTATTTTAAGCTTGTACGATGTT
AC
CCAAGAAGAGAGCAGTATGGGGTCACCCTGCAGCTTTGCAAACACTGCCACATTCTCTCCTGGAAGGG
C
ACTGACCATCCGTGCACGGCCAACAACCCAGAGAGCTGCTCCGTCTCACTTTCCCCTCAAGACTTTATC
AAT
TTGTTCAAGTTCTGA


Translation (355 aa):
MPFLGQDWRSPGQSWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYSKENLFSSLNYDVAAKKRKKDIQN
S
KTKTQ
YFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFNYVVRLLELIAKSQLTSLSGI
A
QKNFMNILEKVVLK
VLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQL
N
SIQISR
PAFKGLTITDLPVCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKRLCQYHFSERQIR
K
RLILSDKGQLDWKKMYFKLVRCYPRREQYGVTLQLCKHCHILSWK
GTDHPCTANNPESCSVSLSPQDFI
N
LFKF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser