NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22167.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22167.1 Public Mus musculus 8 Ccdc70 23 108 98 CCDS HistoryNCBI Gene:67929Re-query CCDS DB by CCDS ID:22167.1See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22167.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000017193.1 ENSMUSP00000017193.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000017193.1Link to Ensembl Protein Viewer:ENSMUSP00000017193.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000017193Re-query CCDS DB by Protein ID:ENSMUSP00000017193
Original member Current member EBI ENSMUST00000070649.1 ENSMUSP00000069249.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070649.1Link to Ensembl Protein Viewer:ENSMUSP00000069249.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000070649Re-query CCDS DB by Protein ID:ENSMUSP00000069249
Original member Current member NCBI NM_001357224.1 NP_001344153.1 Accepted alive Link to Nucleotide Sequence:NM_001357224.1Link to Protein Sequence:NP_001344153.1Re-query CCDS DB by Nucleotide ID:NM_001357224Re-query CCDS DB by Protein ID:NP_001344153Link to BLAST:NP_001344153.1
Original member Current member NCBI NM_026459.4 NP_080735.1 Accepted alive Link to Nucleotide Sequence:NM_026459.4Link to Protein Sequence:NP_080735.1Re-query CCDS DB by Nucleotide ID:NM_026459Re-query CCDS DB by Protein ID:NP_080735Link to BLAST:NP_080735.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001344153.1 223 Q9D9B0 223 100% 0 0
NP_080735.1 223 Q9D9B0 223 100% 0 0

Chromosomal Locations for CCDS 22167.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 8 (NC_000074.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 21973196 21973867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (672 nt):
ATGTTTCCCTTCAAGGTGAGCAAGTGGATGGGACTGGCCTGCCTCCGGTCACTGGTGCTGCCCTCGCCCA
GT
ATCCGTCAGAAGAAATTAATACACAAGCTGCAGGAGGAAAAGGCTTTTCGAGAAGAGATGAAAATTTT
C
CATGAGAAAATCGAAGACTTCAGGGAAGAGATCTGGGAGTTCCGAGGCAAGATCAGGGCTTTCCGGGGC
CAG
ATCCTGGGTTTTTGGGAAGAAGAGAGACCTTTCTGGGAAGAAGAGAAGATCTTCTGGAAGGAAGAAA
AA
ACCTTCTGGGAAATGGAAAAATCTTTCCGGGAAGAAGAGAAGACTTTCTGGAAAAAATACAGAACCTT
C
TGGAAGGAGGACAAGGCATTCTGGAGAGAGGATAATGCTTTATGGGAAAGAGACCGGAATCTTCTTCAG
GAG
GACAAGGCCCTATGGGAGGAGGAAAAGGCCTTGTGGGTAGAGGAAAGAGCCCTGCTTGCAGAAGAAA
AG
GCTTTGTGGGAAGATAAGAAGTCCCTCTGGGAGGAAGAGAATGCCCTCTGGGAGGAAGAAAAAGCCCT
C
TGGGTGGAAGGTGGTGGTTTCCATCTCCTTGGGGAACAGAGGCACCAAAATGGTCCCTACAATGCCAAT
GAA
GAGCCACAGTCAACATCCTTCCCCCGGGGCCGTGCTTAG


Translation (223 aa):
MFPFKVSKWMGLACLRSLVLPSPSIRQKKLIHKLQEEKAFREEMKIFHEKIEDFREEIWEFRGKIRAFRG
Q
ILGFWEEERPFWEEEKIFWKEEKTFWEMEKSFREEEKTFWKKYRTFWKEDKAFWREDNALWERDRNLLQ
E
DKALWEEEKALWVEERALLAEEKALWEDKKSLWEEENALWEEEKALWVEGGGFHLLGEQRHQNGPYNAN
E
EPQSTSFPRGRA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser