NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4758.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4758.1 Under review, update Homo sapiens 6 TAP1 22 109 92 CCDS HistoryNCBI Gene:6890Re-query CCDS DB by CCDS ID:4758.1See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4758.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354258.4 ENSP00000346206.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354258.4Link to Ensembl Protein Viewer:ENSP00000346206.4Re-query CCDS DB by Nucleotide ID:ENST00000354258Re-query CCDS DB by Protein ID:ENSP00000346206
Original member NCBI NM_000593.5 NP_000584.2 Updated not alive Link to Nucleotide Sequence:NM_000593.5Link to Protein Sequence:NP_000584.2Re-query CCDS DB by Nucleotide ID:NM_000593Re-query CCDS DB by Protein ID:NP_000584
Current member NCBI NM_000593.6 NP_000584.3 Pending alive Link to Nucleotide Sequence:NM_000593.6Link to Protein Sequence:NP_000584.3Re-query CCDS DB by Nucleotide ID:NM_000593Re-query CCDS DB by Protein ID:NP_000584Link to BLAST:NP_000584.3

Chromosomal Locations for CCDS 4758.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 32845579 32845785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32847068 32847204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32847513 32847675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32847919 32848092 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32848652 32848840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32848990 32849118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32850320 32850517 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32850944 32851149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32852109 32852239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32852388 32852502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32853039 32853816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2427 nt):
ATGGCTGAGCTTCTCGCCAGCGCAGGATCAGCCTGTTCCTGGGACTTTCCGAGAGCCCCGCCCTCGTTCC
CT
CCCCCAGCCGCCAGTAGGGGAGGACTCGGCGGTACCCGGAGCTTCAGGCCCCACCGGGGCGCGGAGAG
T
CCCAGGCCCGGCCGGGACCGGGACGGCGTCCGAGTGCCAATGGCTAGCTCTAGGTGTCCCGCTCCCCGC
GGG
TGCCGCTGCCTCCCCGGAGCTTCTCTCGCATGGCTGGGGACAGTACTGCTACTTCTCGCCGACTGGG
TG
CTGCTCCGGACCGCGCTGCCCCGCATATTCTCCCTGCTGGTGCCCACCGCGCTGCCACTGCTCCGGGT
C
TGGGCGGTGGGCCTGAGCCGCTGGGCCGTGCTCTGGCTGGGGGCCTGCGGGGTCCTCAGGGCAACGGTT
GGC
TCCAAGAGCGAAAACGCAGGTGCCCAGGGCTGGCTGGCTGCTTTGAAGCCATTAGCTGCGGCACTGG
GC
TTGGCCCTGCCGGGACTTGCCTTGTTCCGAGAGCTGATCTCATGGGGAGCCCCCGGGTCCGCGGATAG
C
ACCAGGCTACTGCACTGGGGAAGTCACCCTACCGCCTTCGTTGTCAGTTATGCAGCGGCACTGCCCGCA
GCA
GCCCTGTGGCACAAACTCGGGAGCCTCTGGGTGCCCGGCGGTCAGGGCGGCTCTGGAAACCCTGTGC
GT
CGGCTTCTAGGCTGCCTGGGCTCGGAGACGCGCCGCCTCTCGCTGTTCCTGGTCCTGGTGGTCCTCTC
C
TCTCTTGGGGAGATGGCCATTCCATTCTTTACGGGCCGCCTCACTGACTGGATTCTACAAGATGGCTCA
GCC
GATACCTTCACTCGAAACTTAACTCTCATGTCCATTCTCACCATAGCCAGTGCAGTGCTGGAGTTCG
TG
GGTGACGGGATCTATAACAACACCATGGGCCACGTGCACAGCCACTTGCAGGGAGAGGTGTTTGGGGC
T
GTCCTGCGCCAGGAGACGGAGTTTTTCCAACAGAACCAGACAGGTAACATCATGTCTCGGGTAACAGAG
GAC
ACGTCCACCCTGAGTGATTCTCTGAGTGAGAATCTGAGCTTATTTCTGTGGTACCTGGTGCGAGGCC
TA
TGTCTCTTGGGGATCATGCTCTGGGGATCAGTGTCCCTCACCATGGTCACCCTGATCACCCTGCCTCT
G
CTTTTCCTTCTGCCCAAGAAGGTGGGAAAATGGTACCAGTTGCTGGAAGTGCAGGTGCGGGAATCTCTG
GCA
AAGTCCAGCCAGGTGGCCATTGAGGCTCTGTCGGCCATGCCTACAGTTCGAAGCTTTGCCAACGAGG
AG
GGCGAAGCCCAGAAGTTTAGGGAAAAGCTGCAAGAAATAAAGACACTCAACCAGAAGGAGGCTGTGGC
C
TATGCAGTCAACTCCTGGACCACTAGTATTTCAGGTATGCTGCTGAAAGTGGGAATCCTCTACATTGGT
GGG
CAGCTGGTGACCAGTGGGGCTGTAAGCAGTGGGAACCTTGTCACATTTGTTCTCTACCAGATGCAGT
TC
ACCCAGGCTGTGGAGGTACTGCTCTCCATCTACCCCAGAGTACAGAAGGCTGTGGGCTCCTCAGAGAA
A
ATATTTGAGTACCTGGACCGCACCCCTCGCTGCCCACCCAGTGGTCTGTTGACTCCCTTACACTTGGAG
GGC
CTTGTCCAGTTCCAAGATGTCTCCTTTGCCTACCCAAACCGCCCAGATGTCTTAGTGCTACAGGGGC
TG
ACATTCACCCTACGCCCTGGCGAGGTGACGGCGCTGGTGGGACCCAATGGGTCTGGGAAGAGCACAGT
G
GCTGCCCTGCTGCAGAATCTGTACCAGCCCACCGGGGGACAGCTGCTGTTGGATGGGAAGCCCCTTCCC
CAA
TATGAGCACCGCTACCTGCACAGGCAGGTGGCTGCAGTGGGACAAGAGCCACAGGTATTTGGAAGAA
GT
CTTCAAGAAAATATTGCCTATGGCCTGACCCAGAAGCCAACTATGGAGGAAATCACAGCTGCTGCAGT
A
AAGTCTGGGGCCCATAGTTTCATCTCTGGACTCCCTCAGGGCTATGACACAGAGGTAGACGAGGCTGGG
AGC
CAGCTGTCAGGGGGTCAGCGACAGGCAGTGGCGTTGGCCCGAGCATTGATCCGGAAACCGTGTGTAC
TT
ATCCTGGATGATGCCACCAGTGCCCTGGATGCAAACAGCCAGTTACAGGTGGAGCAGCTCCTGTACGA
A
AGCCCTGAGCGGTACTCCCGCTCAGTGCTTCTCATCACCCAGCACCTCAGCCTGGTGGAGCAGGCTGAC
CAC
ATCCTCTTTCTGGAAGGAGGCGCTATCCGGGAGGGGGGAACCCACCAGCAGCTCATGGAGAAAAAGG
GG
TGCTACTGGGCCATGGTGCAGGCTCCTGCAGATGCTCCAGAATGA


Translation (808 aa):
MAELLASAGSACSWDFPRAPPSFPPPAASRGGLGGTRSFRPHRGAESPRPGRDRDGVRVPMASSRCPAPR
G
CRCLPGASLAWLGTVLLLLADWVLLRTALPRIFSLLVPTALPLLRVWAVGLSRWAVLWLGACGVLRATV
G
SKSENAGAQGWLAALKPLAAALGLALPGLALFRELISWGAPGSADSTRLLHWGSHPTAFVVSYAAALPA
A
ALWHKLGSLWVPGGQGGSGNPVRRLLGCLGSETRRLSLFLVLVVLSSL
GEMAIPFFTGRLTDWILQDGS
A
DTFTRNLTLMSILTIA
SAVLEFVGDGIYNNTMGHVHSHLQGEVFGAVLRQETEFFQQNQTGNIMSRVTE
D
TSTLSDSLSENLSLFLWYLVRGLCLLGIMLWGSVSLTMVTLITLPLLFLLPKKVGKWYQ
LLEVQVRESL
A
KSSQVAIEALSAMPTVRSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVNSWTTS
ISGMLLKVGILYIG
G
QLVTSGAVSSGNLVTFVLYQMQFTQAVE
VLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGLLTPLHLE
G
LVQFQDVSFAYPNRPDVLVLQ
GLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPLP
Q
YEHRYLHRQ
VAAVGQEPQVFGRSLQENIAYGLTQKPTMEEITAAAVKSGAHSFISGLPQGYDTEVDEAG
S
QLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQ
VEQLLYESPERYSRSVLLITQHLSLVEQAD
H
ILFLEGGAIREGGTHQQLMEKKGCYWAMVQAPADAPE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser