NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38904.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38904.1 Public Mus musculus 4 Trnp1 23 108 98 CCDS HistoryNCBI Gene:69539Re-query CCDS DB by CCDS ID:38904.1See the combined annotation on chromosome 4 in Sequence Viewer

Public Note for CCDS 38904.1
This CCDS ID represents the protein described in PMID: 16792503 and is supported by the mRNA BC049168.1. It should be noted that this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because it was detected endogenously in PMID: 16792503. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 38904.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000125541.1 ENSMUSP00000129613.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000125541.1Link to Ensembl Protein Viewer:ENSMUSP00000129613.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000125541Re-query CCDS DB by Protein ID:ENSMUSP00000129613
Original member Current member NCBI NM_001081156.2 NP_001074625.1 Accepted alive Link to Nucleotide Sequence:NM_001081156.2Link to Protein Sequence:NP_001074625.1Re-query CCDS DB by Nucleotide ID:NM_001081156Re-query CCDS DB by Protein ID:NP_001074625Link to BLAST:NP_001074625.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074625.1 223 Q80ZI1 223 100% 0 0

Chromosomal Locations for CCDS 38904.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 133497786 133498457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (672 nt):
ATGCCGGGCTGCCGAATCAGCGCCTGCGGCCCAGGGGCCCAGGAAGGGACGGCAGAACCGGGGTCGCCCC
CG
CCGCCACCCCGGGAGCCCCTGCCGTCCCTCCAGCCCCCTTCCCCATCGCCGACCTCGACTCCGACCCC
C
ACTAAGTCACCGCCCTTACCCGAGGCGGCCGAGACACCCGTGGAAGGGCAGGAGCTGCAGCGCTGGCGC
CAG
GGTGCTAGTGGGGGGTCTGGGGGCGCGGGCCCGGCGGGGATCGCGGGCGCGGCGGCGGGGGCAGGGG
GC
CGTGCGCTGGAGCTGGCCGAAGCGCGGCGGCGACTGCTAGAAGTGGAGGGCCGCCGGCGCCTGGTGTC
G
GAGCTGGAGAGCCGGGTGCTGCAGCTGCACCGAGTCTTCTTGGCTGCGGAGCTGCGCCTGGCGCATCGC
GCC
GAGAGCCTGAGCCGCCTGAGCGGCGGCGTGGCCCAGGCCGAGCTCTACCTGGCTGCGCACGGGTCCC
GT
CTCAAGAAGGGTGCGCGCCGCGGTCGCCGGGGTCGTCCCCCGGCGCTGCTGGCGTCCGCGCTCGGCCT
G
GGGAGCTGCGTGCCCTGGGGCGCAGGGCGGCTACGGCGCGGCCAGGGCCCGGAGCCCGACTCGCCCTTC
CGC
CGCAGCCCGCCCCGCGGCCCCGCCTCCCCCCAGCGCTGA


Translation (223 aa):
MPGCRISACGPGAQEGTAEPGSPPPPPREPLPSLQPPSPSPTSTPTPTKSPPLPEAAETPVEGQELQRWR
Q
GASGGSGGAGPAGIAGAAAGAGGRALELAEARRRLLEVEGRRRLVSELESRVLQLHRVFLAAELRLAHR
A
ESLSRLSGGVAQAELYLAAHGSRLKKGARRGRRGRPPALLASALGLGSCVPWGAGRLRRGQGPEPDSPF
R
RSPPRGPASPQR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser