NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS37079.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37079.1 Public Mus musculus 15 Atad2 23 108 98 CCDS HistoryNCBI Gene:70472Re-query CCDS DB by CCDS ID:37079.1See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37079.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000038194.4 ENSMUSP00000043691.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000038194.4Link to Ensembl Protein Viewer:ENSMUSP00000043691.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000038194Re-query CCDS DB by Protein ID:ENSMUSP00000043691
Original member Current member NCBI NM_027435.2 NP_081711.2 Accepted alive Link to Nucleotide Sequence:NM_027435.2Link to Protein Sequence:NP_081711.2Re-query CCDS DB by Nucleotide ID:NM_027435Re-query CCDS DB by Protein ID:NP_081711Link to BLAST:NP_081711.2

Chromosomal Locations for CCDS 37079.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 58095527 58095571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58096577 58096705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58097252 58097385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58098359 58098748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58099711 58099854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58099967 58100089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58102377 58102536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58103198 58103394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58104431 58104566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58105477 58105662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58106725 58106911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58108081 58108195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58108303 58108617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58109948 58110038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58111117 58111276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58114170 58114258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58115672 58115846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58116768 58116883 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58117238 58117346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58118345 58118449 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58120942 58121059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58122453 58122602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58125742 58125829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58126048 58126150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58126549 58126714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58128209 58128255 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58132193 58132341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58134807 58134974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4095 nt):
ATGGTGGTCCTCCGCAGCAGCCTGGAGCTGCACAGTCGCTCCACCACCTCCTCGGCCACCGACTCTCTGG
AC
CTGTCCAGTGAGTTCCTCAGCCTGCAGGACAGCGGCGGGAGGCGGCCCAGATTGCGCCGAGCCGGGAG
G
AAATCGACGGCGTCCAAGGCGGCGGGCGATGGATTCACAGTTAAGGGAGCTGAAACCTACCACAACACG
CGC
TCTTTAAGGTCTCTGAGAAACCAAGCACAAACTTCTTCAGAGTCTAGTTTTGACAAGAACGTGGACA
GA
ACAGAGAAATACTCCAATGGCAGACATTTCACAAGGCAATTTGCTCGACAGCAGGCTGATAAAAAAGA
A
GAGTGCAAAGAAGACAAAGTTATTCCAGTTATTCGCTCATTGAGGAATAGAAACATTGCTCCAACTGCA
GAA
CATTTGCACGAACAAAGTGGAGATGTTGAAGTTCGAAGAAGTTGCAGGATTAGAAGTCGTTACAGTA
CC
ATGAACCAGTCTGTGCTATTTGACAAGCTTATAACAAACACTGCTGAAGCTGTACTTCAAAAGATGGA
T
GACATGAAAAAGATGCGCAGACAGCGGATGAAGAAGCTTGAAGACTTGGGAGTATTCAATGAAACAGAA
GAG
AGTAATCTCACTATGTACACAAGAGGAAAACTAAAGGCTATCCAGCGAGCTGATGAAGAAACAACTG
AT
AACCAGGACGGCAGTGTGGAATCATCTGAAGAGGGGGAAGAGCAAGAGGATGATGATGGCGAAGATGA
A
GATGATGAAGATGAAGAAGAGGGAGAAGAAGATAATCAAAAAAGATACTATCTTAGGCAGAGAAAAACA
ACG
GTTTACTACCAGTCTCCACTGGAAAGTAAACCTCGTCACCAGAGAAAGCCCAACATGTTTTATAGTG
GC
CCAGCTTCTCCTGCAAGACCAAGATTCCGCTTGTCTTCTACGGGACCAAGAAGTCCCTATTGTAAACG
A
ATGAGCAGGCGAAGGCATGCCATCCACAGCAGTGACTCTACTTCCTCCTCCTCCTCTGAAGACGACTGT
TTT
GAGAGGAGAACAAAAAGGAACCGAAATAGAGCTATTAACAGGTGCCTCCCACTAAATTTTCGGAAAG
AT
GAAATAAGAGGGATTTATAAAGATCGAATGAAAATTGGAGCAAGCCTTGCTGATGTTGACCCAATGCA
A
CTAGATACTTCAGTGCGCTTTGACAGTGTTGGCGGCCTGTCCAGTCACATTGCAGCTCTAAAAGAGATG
GTG
GTGTTTCCCTTACTTTATCCAGAAGTCTTCGAAAAGTTTAAAATTCAACCCCCAAGAGGTTGTTTGT
TT
TATGGACCACCTGGAACTGGAAAAACCCTGGTTGCTAGAGCACTTGCCAATGAGTGCAGCCGAGGGGA
T
AAGAGAGTGGCGTTCTTCATGAGGAAAGGTGCTGACTGCCTGAGTAAATGGGTAGGAGAATCTGAGAGA
CAG
CTTCGGTTGCTATTTGACCAGGCCTATCAGATGCGCCCAGCAATTATATTCTTTGATGAAATTGATG
GT
TTGGCTCCAGTACGATCTAGCAGGCAAGATCAGATTCACAGTTCTATTGTTTCAACCCTGTTAGCTCT
T
ATGGATGGTTTGGACAGCAGAGGAGAAATTGTGGTCATTGGAGCTACCAACCGGCTAGATTCCATAGAC
CCT
GCTTTACGGAGGCCCGGTCGGTTTGACAGAGAATTCCTTTTTAGTCTACCTGATAAAAATGCTCGAA
AA
GAGATTCTGAAGATTCATACAAGAGATTGGAATCCAAAGCCAGTGGACATGTTTCTAGAAGAACTAGC
A
GAACACTGTGTTGGCTACTGTGGTGCGGATATTAAGTCAATCTGTGCTGAAGCTGCTTTGTGCGCCCTG
CGT
CGACGGTACCCGCAGATCTACACCACCAGCGAGAAGCTTCAGCTGGATCTCTCTTCAATTACCATCT
CA
GCTAAGGATTTTGAGGCAGCTCTGCAGAAAATAAGACCAGCTTCCCAGAGAGCTGTGACATCACCCGG
A
CAGGCACTGTCTGCCATTGTGAAACCACTTCTGCAAAATACTGTTCATAGGATCTTAGACGCCCTACAG
AAA
GTATTTCCACATGTGGAAGTTGGAACAAACAAATCTTTAAATTCAGATGTTTCTTGCCCTTTTCTAG
AA
AGTGATTTGGCATACAGTGATGATGATACACCATCTGTGTATGAAAATGGACTTTCTCAAAAAGAAAA
T
TTAAATTTTCTTCATTTAAATAGAAATGCCTGTTACCAGCCTATGTCTTTTCGACCAAGACTATTGATA
GTG
GGAGAACCAGGATTTGGACAGAGTTCTCACTTGGCACCAGCTGTCATCCATGCTTTGGAAAAATTTA
CT
GTATATACATTAGACATTCCTGTTCTTTTTGGCATCAGTACAACATCTCCTGAAGAGGCATGTTCCCA
A
ATGATTCGTGAAGCTAAGAGAACAGCACCCAGCATAGTCTATGTCCCACATATCCATTTGTGGTGGGAA
ATA
GTTGGACCGACACTCAAAGCCACATTTACAACATTATTACAGACTATACCTTCATTTGCTCCAGTTT
TA
TTACTTGCAACTTCTGAGAAACCATACTCAGCTTTGCCGGAAGAGGTACAAGAATTGTTTACCCATGA
T
TATGGAGAAATTTTTAATGTACAGTTACCAGATAAAGAAGAACGAACCAAATTTTTTGAAGACTTAATT
TTA
AAACAAGCTTCAAAGCCTCCTGTGTCACAAAAGAAAGCAGTTCTGCAGGCCTTGGAGGTGCTCCCAG
TC
GCACCACCGCCTGAACCAAGACCACTGACAGCAGAGGAAGTTAAACGGCTTGAAGAACAAGAAGAAGA
T
ACATTCAGAGAACTCAGGATTTTCTTAAGAAATGTCACACATAGACTTGCTATTGATAAGCGATTCCGA
GTC
TTTACTAAGCCTGTTGACCCTGATGAGGTTCCTGATTATGTCACTGTCATAAAGCAACCAATGGACC
TT
TCATCTGTAATCAGTAAAATTGATTTACATAAATATCTCACTGTGAAAGACTATTTGAAGGATATTGA
T
CTAATCTGTAGTAATGCTTTAGAATACAATCCAGATAGAGATCCTGGAGATCGTCTTATTAGGCATAGA
GCT
TGTGCTTTGAGAGACACTGCTTATGCAATAATTAAAGAGGAGCTTGATGAAGACTTTGAGCAGCTCT
GT
GAAGAAATTCAGGAATCTCGGAAGAAGAGAGGTTGTAGCTCCTCCAAATACGCACCATCTTATTACCA
C
GTCATGCCAAAGCAAAATTCTCCTCCTGTTGGTGATAAAAAGCCAGATCAAGAGCAGAATGAGAAGCTA
AAG
GTACCGTGCACTCCTGTGGCGTGCAGCACACCTGCTCAGTTGAAAAGAAAATTCCATAAAAAGTCAA
AG
TGGCATGTAGGCACCAAAATAAAGCGAAGGAAAATTTCACAAGCTAAAGACAACAGCTTGAATGCTAT
G
AACAGTTCAAGCAGGAGCGACACAGAAGACAGCCAGCACACACATGCAGAGCACACGGAGCCTGGAAAC
ACG
GACGAGTCCTCGGTAGAAGAAAGTGACAAGCAAAATAGACTTGAAAGCAACATAGACTTGAAAAATA
AC
TCAAGTTCCTCTAATATTGAGAATGAACTTGAAGAGCCTAAGGAAACTACGGAGGGCACAGAACTGAG
A
AAAGACAGGATTGTTTGCAGGGGTGATGCCTCTGCCTCCCAGGTCACAGACATTCCCGAAGACAGTGAA
TCA
AAAGAAATGGATTTTCTGCGGATGACTCTAGCTAGAGGTTCCCAGGTAGAGCAGCAGGAGCTCATCA
GT
ATGGAGCAGGCTCTGGCCATCCTCTCTCAGCCGACACCCTCACTTGTGCTGGACCACAAGCAGTTAAC
A
AATATTTTGAAGACGGTTGTTAAAAAAAGTCAGAAATATAATATATTCCAACTGGAGAATTTGTATGCA
GTA
ATCAGCCAGTGTATTTATGAGCACCGCAGGGACTATGACAAAACAGCGCTTGTTCAGAAAATGGAGC
AA
GCAGTAGAAAACTTCAATTGTTCCAGATCATAG


Translation (1364 aa):
MVVLRSSLELHSRSTTSSATDSLDLSSEFLSLQDSGGRRPRLRRAGRKSTASKAAGDGFTVKGAETYHNT
R
SLRSLRNQAQTSSESSFDKNVDRTEKYSNGRHFT
RQFARQQADKKEECKEDKVIPVIRSLRNRNIAPTA
E
HLHEQSGDVEVRRSCRIRSRYSTMNQSVLFDKLIT
NTAEAVLQKMDDMKKMRRQRMKKLEDLGVFNETE
E
SNLTMYTRGKLKAIQRADEETTDNQDGSVESSEEGEEQEDDDGEDEDDEDEEEGEEDNQKRYYLRQRKT
T
VYYQSPLES
KPRHQRKPNMFYSGPASPARPRFRLSSTGPRSPYCKRMSRRRHAIHSSDSTSSSSSEDDC
F
ERRTKRNRNRAIN
RCLPLNFRKDEIRGIYKDRMKIGASLADVDPMQLDTSVRFDSVGGLSSHIAALKEM
V
VFPLLYPEVFEKFKIQPP
RGCLFYGPPGTGKTLVARALANECSRGDKRVAFFMRKGADCLSKWVGESER
Q
LRLLFDQ
AYQMRPAIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSID
P
ALRRPGRFDREFLFSLPDKN
ARKEILKIHTRDWNPKPVDMFLEELAEHCVGYCGADIKSICAEAALCAL
R
RRYPQIYTTSEKLQLDLSSITISAKDFEAALQKIRPASQRAVTSPGQALSAIVKPLLQNTVHRILDALQ
K
VFPHVEVGTNKSLNS
DVSCPFLESDLAYSDDDTPSVYENGLSQKENLNFLHLNRNACYQPMSFRPRLLI
V
GEPGFGQSSHLAPAVIHALEKFTVYTLDIPVLFGISTTSPEEACSQ
MIREAKRTAPSIVYVPHIHLWWE
I
VGPTLKATFTTLLQTIPSFAPVLLLATSEKPYSALPEE
VQELFTHDYGEIFNVQLPDKEERTKFFEDLI
L
KQASKPPVSQKKA
VLQALEVLPVAPPPEPRPLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFR
V
FTKPVDPDE
VPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYLKDIDLICSNALEYNPDRDPGDRLIRHR
A
CALRDTAYAIIKEELDEDFEQLCEEIQESRKKR
GCSSSKYAPSYYHVMPKQNSPPVGDKKPDQEQNEKL
K
VPCTPVACSTP
AQLKRKFHKKSKWHVGTKIKRRKISQAKDNSLNAMNSSSRSDTEDSQHTHAEHTEPGN
T
DESSVEESDKQNRLESNIDLKNNSSSSNIENELEEPKETTEGTELRKDRIVCRGDASASQVTDIPEDSE
S
K
EMDFLRMTLARGSQVEQQELISMEQALAILSQPTPSLVLDHKQLTNILKTVVKKSQKYNIFQLENLYA
V
ISQCIYEHRRDYDKTALVQ
KMEQAVENFNCSRS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser