NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29032.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29032.2 Public Mus musculus 18 Cul2 23 108 98 CCDS HistoryNCBI Gene:71745Re-query CCDS DB by CCDS ID:29032.2See the combined annotation on chromosome 18 in Sequence Viewer

Public Note for CCDS 29032.1
The coding region has been updated to represent an alternate splice pattern that is more supported by the available transcript and protein data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 29032.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000162301.7 ENSMUSP00000125403.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000162301.7Link to Ensembl Protein Viewer:ENSMUSP00000125403.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000162301Re-query CCDS DB by Protein ID:ENSMUSP00000125403
Original member Current member NCBI NM_001360829.1 NP_001347758.1 Accepted alive Link to Nucleotide Sequence:NM_001360829.1Link to Protein Sequence:NP_001347758.1Re-query CCDS DB by Nucleotide ID:NM_001360829Re-query CCDS DB by Protein ID:NP_001347758Link to BLAST:NP_001347758.1
Original member Current member NCBI NM_029402.3 NP_083678.2 Accepted alive Link to Nucleotide Sequence:NM_029402.3Link to Protein Sequence:NP_083678.2Re-query CCDS DB by Nucleotide ID:NM_029402Re-query CCDS DB by Protein ID:NP_083678Link to BLAST:NP_083678.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001347758.1 745 Q9D4H8-1 745 100% 0 0
NP_083678.2 745 Q9D4H8-1 745 100% 0 0

Chromosomal Locations for CCDS 29032.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 3399868 3399986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3405685 3405787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3414130 3414224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3417535 3417640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3418564 3418646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3419347 3419443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3419532 3419642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3421203 3421365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3423469 3423593 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3424450 3424557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3425512 3425571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3426095 3426223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3426317 3426403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3426758 3426910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3427163 3427240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3429570 3429636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3430912 3431114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3431484 3431585 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3433994 3434110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 3434844 3434975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2238 nt):
ATGTCTTTAAAACCAAGAGTAGTGGATTTTGATGAGACATGGAACAAACTCCTAACTACAATCAAAGCTG
TT
GTTATGTTGGAATATGTCGAGCGAGCAACATGGAATGACCGCTTCTCAGATATCTATGCTTTATGTGT
G
GCCTATCCTGAACCACTTGGAGAAAGACTTTATGCGGAAACAAAGATTTTTTTGGAAAGTCACGTTCGG
CAT
TTGTATAAGAGAGTTCTGGAGTCTGAAGAACAAGTGCTTGTTATGTATCATAGGTACTGGGAAGAAT
AC
AGCAAAGGCGCCGACTATATGGACTGCTTATATAGGTATCTCAATACCCAGTATATTAAAAAGAATAA
A
TTGACAGAAGCTGATATACAGTATGGCTATGGTGGAGTAGATATGAATGAACCACTTATGGAAATAGGA
GAG
CTAGCATTGGATATGTGGAGGAAGTTAATGGTTGAACCCCTTCAGAACATCCTCATCCGGATGCTGC
TT
CGAGAAATTAAAAATGATCGTGGTGGTGAAGATCCAAACCAGAAAGTAATCCATGGGGTTATTAACTC
C
TTTGTTCATGTTGAACAGTATAAGAAAAAATTTCCCTTAAAGTTTTATCAGGGAATATTCGTGTCTCCC
TTT
CTGACTGAAACGGGAGAATATTACAAGCAAGAAGCTTCAAATTTATTACAAGAATCAAATTGTTCAC
AG
TATATGGAAAAGGTTCTAGGTAGATTAAAAGATGAAGAAATTAGATGTCGAAAATATTTGCATCCAAG
T
TCATATACTAAAGTGATTCATGAGTGTCAGCAGCGGATGGTAGCAGACCACTTACAGTTCTTACATTCA
GAG
TGCCACAGCATCATTCAGCAAGAGAGGAAGAACGACATGGCAAATATGTACGTCTTACTCCGTGCTG
TG
TCCAGTGGTTTACCTCATATGATTGAGGAGCTGCAGAAACATATCCATGACGAGGGCCTCAGAGCGAC
C
AGTAACCTTACTCAGGAACATATGCCAACACTATTTGTGGAATCAGTTTTGGAAGTACATGGTAAATTC
GTT
CAACTTATCAACACTGTTTTGAATGGTGATCAGCATTTTATGAGTGCTTTAGATAAGGCCCTTACAT
CT
GTTGTAAATTACAGAGAACCCAAGTCTGTTTGCAAAGCGCCTGAACTGCTTGCTAAGTACTGTGACAA
C
TTGCTAAAGAAGTCAGCGAAGGGGATGACTGAAAATGAAGTGGAGGACAAGCTCACTAGCTTCATCACA
GTT
TTCAAGTACATTGATGACAAGGACGTCTTTCAGAAGTTCTATGCAAGAATGCTAGCAAAACGTCTAA
TT
CACGGGTTGTCTATGTCTATGGATTCTGAAGAAGCCATGATCAATAAATTAAAGCAAGCCTGTGGTTA
T
GAGTTTACCAGCAAGCTGCATCGAATGTATACAGACATGAGTGTCAGCGCTGATTTGAACAATAAGTTC
AAC
AATTTCATCAGAAACCAAGACACCGTGATTGACTTGGGGATTAGTTTCCAAATATATGTTCTTCAGG
CT
GGTGCGTGGCCTCTCACTCAGGCTCCTTCATCTACATTTGCAATTCCCCAAGAGCTAGAGAAAAGTGT
A
CAGATGTTTGAATTGTTTTATAGCCAGCATTTCAGTGGACGGAAGCTGACATGGTTGCATTATCTCTGT
ACA
GGTGAAGTTAAAATGAACTATTTGGGAAAACCATATGTAGCTATGGTTACAACCTACCAAATGGCAG
TT
CTTCTTGCCTTTAACAACAGTGAAACTGTCAGCTACAAAGAACTTCAAGACAGTACCCAGATGAATGA
A
AAGGAGCTGACCAAAACAATCAAATCATTACTTGATGTGAAAATGATTAACCATGATTCAGAAAAGGAA
GAT
ATCGATGCAGAATCTTCATTTTCATTAAATATGAGCTTCAGCAGTAAGAGAACAAAATTTAAGATTA
CT
ACGTCAATGCAGAAGGATACGCCACAAGAACTGGAACAGACTAGAAGTGCTGTAGATGAGGACCGGAA
A
ATGTATCTTCAAGCTGCTATTGTCCGCATCATGAAAGCACGAAAAGTGCTTCGGCACAACGCCCTCATT
CAA
GAGGTAATCAGCCAGTCAAGAGCCAGGTTCAATCCCAGTATCAGCATGATTAAGAAGTGCATAGAAG
TT
CTGATAGACAAACAGTACATCGAGCGCAGCCAAGCATCTGCAGATGAATACAGTTACGTCGCATGA


Translation (745 aa):
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYAETKIFLESHVR
H
LYK
RVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQYIKKNKLTEADIQYGYGGVDMNEPLMEIG
E
LALDMWRKLMVEPLQNILIRMLLREIKNDRGGEDPNQKVIHGVINSFVHVEQYKKKFPLKFYQGIFVSP
F
LTETGEYYKQEASNLLQESNCSQYMEK
VLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHS
E
CHSIIQQERKN
DMANMYVLLRAVSSGLPHMIEELQKHIHDEGLRATSNLTQEHMPTLFVESVLEVHGKF
V
QLINTVLNGDQHFMSALDK
ALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDKLTSFIT
V
FKYIDDKDVFQK
FYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKF
N
NFIRNQDTVIDLGISFQIYVLQ
AGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLC
T
GEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQDSTQMNEKELTKTIKSLLDVKMINHDSEKE
D
IDAESSFSLNMSFSSKRTKFKITTSMQKDTPQ
ELEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI
Q
E
VISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser