NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, September 21, 2021, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS23478.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
23478.1 Public Mus musculus 9 Abhd14b 23 108 98 CCDS HistoryNCBI Gene:76491Re-query CCDS DB by CCDS ID:23478.1See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 23478.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000048527.14 ENSMUSP00000038755.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000048527.14Link to Ensembl Protein Viewer:ENSMUSP00000038755.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000048527Re-query CCDS DB by Protein ID:ENSMUSP00000038755
Original member Current member EBI ENSMUST00000185347.7 ENSMUSP00000140279.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000185347.7Link to Ensembl Protein Viewer:ENSMUSP00000140279.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000185347Re-query CCDS DB by Protein ID:ENSMUSP00000140279
Original member Current member EBI ENSMUST00000213179.1 ENSMUSP00000149694.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000213179.1Link to Ensembl Protein Viewer:ENSMUSP00000149694.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000213179Re-query CCDS DB by Protein ID:ENSMUSP00000149694
Original member Current member EBI ENSMUST00000216130.1 ENSMUSP00000150885.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000216130.1Link to Ensembl Protein Viewer:ENSMUSP00000150885.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000216130Re-query CCDS DB by Protein ID:ENSMUSP00000150885
Original member Current member NCBI NM_029631.3 NP_083907.3 Accepted alive Link to Nucleotide Sequence:NM_029631.3Link to Protein Sequence:NP_083907.3Re-query CCDS DB by Nucleotide ID:NM_029631Re-query CCDS DB by Protein ID:NP_083907Link to BLAST:NP_083907.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083907.3 210 Q8VCR7 210 99.5238% 0 1

Chromosomal Locations for CCDS 23478.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 9 (NC_000075.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 106450021 106450231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 106451393 106451634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 106451984 106452163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (633 nt):
ATGGCCGGTGTGGACCAGCATGAGGGCACCATCAAGGTGCAGGGCCAGAACCTCTTCTTCAGAGAGACCC
GG
CCTGGGAGTGGGCAGCCTGTCCGCTTCTCTGTGCTGCTGCTGCATGGTATCCGCTTCTCCTCGGAGAC
T
TGGCAGAACCTGGGTACTCTGCAGAGGCTGGCCGAGGCTGGCTACAGGGCTGTGGCCATTGATCTGCCA
G
GT
CTTGGGCGATCCAAGGAAGCAGCAGCCCCTGCCCCTATTGGGGAACCGGCCCCTGGCAGCTTCCTAG
CT
GCTGTGGTGGATACCTTGGAGCTGGGACCCCCAGTTGTGATCAGTCCATCATTAAGTGGCATGTATTC
A
CTGCCCTTCCTCGTGGCCCCCGGGTCCCAACTCCGGGGCTTTGTACCAGTGGCTCCTATCTGCACAGAC
AAA
ATCAATGCTGTGGACTACGCCAGTGTGAAGACTCCAGCTCTCATTGTATATGGAGACCAGGACCCCA
TG
GGCTCCTCCAGCTTTCAACACCTGAAGCAGCTGCCCAACCACAGAGTGCTGGTCATGGAAGGGGCAGG
G
CATCCCTGTTACTTGGACAAGCCTGATGAGTGGCATAAGGGGCTGCTGGATTTCCTGCAAGGGCTAGCC
TGA


Translation (210 aa):
MAGVDQHEGTIKVQGQNLFFRETRPGSGQPVRFSVLLLHGIRFSSETWQNLGTLQRLAEAGYRAVAIDLP
G
LGRSKEAAAPAPIGEPAPGSFLAAVVDTLELGPPVVISPSLSGMYSLPFLVAPGSQLRGFVPVAPICTD
K
INAVDYASVK
TPALIVYGDQDPMGSSSFQHLKQLPNHRVLVMEGAGHPCYLDKPDEWHKGLLDFLQGLA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser