NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6893.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6893.1 Public Homo sapiens 9 BBLN 22 109 92 CCDS HistoryNCBI Gene:79095Re-query CCDS DB by CCDS ID:6893.1See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6893.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000372994.1 ENSP00000362085.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372994.1Link to Ensembl Protein Viewer:ENSP00000362085.1Re-query CCDS DB by Nucleotide ID:ENST00000372994Re-query CCDS DB by Protein ID:ENSP00000362085
Original member NCBI NM_024112.3 NP_077017.1 Updated not alive Link to Nucleotide Sequence:NM_024112.3Link to Protein Sequence:NP_077017.1Re-query CCDS DB by Nucleotide ID:NM_024112Re-query CCDS DB by Protein ID:NP_077017
Current member NCBI NM_024112.4 NP_077017.1 Accepted alive Link to Nucleotide Sequence:NM_024112.4Link to Protein Sequence:NP_077017.1Re-query CCDS DB by Nucleotide ID:NM_024112Re-query CCDS DB by Protein ID:NP_077017Link to BLAST:NP_077017.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_077017.1 83 Q9BUW7 83 100% 0 0

Chromosomal Locations for CCDS 6893.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 128160408 128160486 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128163443 128163615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (252 nt):
ATGTCGGGCCCCAACGGAGACCTGGGGATGCCGGTGGAGGCGGGAGCGGAAGGCGAGGAGGACGGCTTCG
GG
GAAGCAGAATACGCTGCCATCAACTCCATGCTGGACCAGATCAACTCCTGTCTGGACCACCTGGAGGA
G
AAGAATGACCACCTCCACGCCCGCCTCCAGGAGCTGCTGGAGTCCAACCGGCAGACACGCCTGGAGTTC
CAG
CAGCAGCTCGGGGAGGCCCCCAGTGATGCCAGCCCCTAG


Translation (83 aa):
MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEF
Q
QQLGEAPSDASP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser