NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4447.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4447.1 Public Homo sapiens 5 CANX 22 109 92 CCDS HistoryNCBI Gene:821Re-query CCDS DB by CCDS ID:4447.1See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4447.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000247461.8 ENSP00000247461.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000247461.8Link to Ensembl Protein Viewer:ENSP00000247461.4Re-query CCDS DB by Nucleotide ID:ENST00000247461Re-query CCDS DB by Protein ID:ENSP00000247461
Original member Current member EBI ENST00000452673.6 ENSP00000391646.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000452673.6Link to Ensembl Protein Viewer:ENSP00000391646.2Re-query CCDS DB by Nucleotide ID:ENST00000452673Re-query CCDS DB by Protein ID:ENSP00000391646
Original member Current member EBI ENST00000504734.5 ENSP00000424063.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000504734.5Link to Ensembl Protein Viewer:ENSP00000424063.1Re-query CCDS DB by Nucleotide ID:ENST00000504734Re-query CCDS DB by Protein ID:ENSP00000424063
Original member NCBI NM_001024649.1 NP_001019820.1 Updated not alive Link to Nucleotide Sequence:NM_001024649.1Link to Protein Sequence:NP_001019820.1Re-query CCDS DB by Nucleotide ID:NM_001024649Re-query CCDS DB by Protein ID:NP_001019820
Current member NCBI NM_001024649.2 NP_001019820.1 Accepted alive Link to Nucleotide Sequence:NM_001024649.2Link to Protein Sequence:NP_001019820.1Re-query CCDS DB by Nucleotide ID:NM_001024649Re-query CCDS DB by Protein ID:NP_001019820Link to BLAST:NP_001019820.1
Original member NCBI NM_001746.3 NP_001737.1 Updated not alive Link to Nucleotide Sequence:NM_001746.3Link to Protein Sequence:NP_001737.1Re-query CCDS DB by Nucleotide ID:NM_001746Re-query CCDS DB by Protein ID:NP_001737
Current member NCBI NM_001746.4 NP_001737.1 Accepted alive Link to Nucleotide Sequence:NM_001746.4Link to Protein Sequence:NP_001737.1Re-query CCDS DB by Nucleotide ID:NM_001746Re-query CCDS DB by Protein ID:NP_001737Link to BLAST:NP_001737.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001019820.1 592 P27824-1 592 100% 0 0
NP_001737.1 592 P27824-1 592 100% 0 0

Chromosomal Locations for CCDS 4447.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 179705682 179705852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179706258 179706331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179707132 179707190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179708239 179708380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179708978 179709059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179709873 179710065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179716105 179716294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179719668 179719781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179720404 179720560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179722804 179723019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179723660 179723779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179724657 179724783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179726680 179726759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 179728591 179728644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1779 nt):
ATGGAAGGGAAGTGGTTGCTGTGTATGTTACTGGTGCTTGGAACTGCTATTGTTGAGGCTCATGATGGAC
AT
GATGATGATGTGATTGATATTGAGGATGACCTTGACGATGTCATTGAAGAGGTAGAAGACTCAAAACC
A
GATACCACTGCTCCTCCTTCATCTCCCAAGGTTACTTACAAAGCTCCAGTTCCAACAGGGGAAGTATAT
TTT
GCTGATTCTTTTGACAGAGGAACTCTGTCAGGGTGGATTTTATCCAAAGCCAAGAAAGACGATACCG
AT
GATGAAATTGCCAAATATGATGGAAAGTGGGAGGTAGAGGAAATGAAGGAGTCAAAGCTTCCAGGTGA
T
AAAGGACTTGTGTTGATGTCTCGGGCCAAGCATCATGCCATCTCTGCTAAACTGAACAAGCCCTTCCTG
TTT
GACACCAAGCCTCTCATTGTTCAGTATGAGGTTAATTTCCAAAATGGAATAGAATGTGGTGGTGCCT
AT
GTGAAACTGCTTTCTAAAACACCAGAACTCAACCTGGATCAGTTCCATGACAAGACCCCTTATACGAT
T
ATGTTTGGTCCAGATAAATGTGGAGAGGACTATAAACTGCACTTCATCTTCCGACACAAAAACCCCAAA
ACG
GGTATCTATGAAGAAAAACATGCTAAGAGGCCAGATGCAGATCTGAAGACCTATTTTACTGATAAGA
AA
ACACATCTTTACACACTAATCTTGAATCCAGATAATAGTTTTGAAATACTGGTTGACCAATCTGTGGT
G
AATAGTGGAAATCTGCTCAATGACATGACTCCTCCTGTAAATCCTTCACGTGAAATTGAGGACCCAGAA
GAC
CGGAAGCCCGAGGATTGGGATGAAAGACCAAAAATCCCAGATCCAGAAGCTGTCAAGCCAGATGACT
G
G
GATGAAGATGCCCCTGCTAAGATTCCAGATGAAGAGGCCACAAAACCCGAAGGCTGGTTAGATGATGA
G
CCTGAGTACGTACCTGATCCAGACGCAGAGAAACCTGAGGATTGGGATGAAGACATGGATGGAGAATGG
GAG
GCTCCTCAGATTGCCAACCCTAGATGTGAGTCAGCTCCTGGATGTGGTGTCTGGCAGCGACCTGTGA
TT
GACAACCCCAATTATAAAGGCAAATGGAAGCCTCCTATGATTGACAATCCCAGTTACCAGGGAATCTG
G
AAACCCAGGAAAATACCAAATCCAGATTTCTTTGAAGATCTGGAACCTTTCAGAATGACTCCTTTTAGT
GCT
ATTGGTTTGGAGCTGTGGTCCATGACCTCTGACATTTTTTTTGACAACTTTATCATTTGTGCTGATC
GA
AGAATAGTTGATGATTGGGCCAATGATGGATGGGGCCTGAAGAAAGCTGCTGATGGGGCTGCTGAGCC
A
GGCGTTGTGGGGCAGATGATCGAGGCAGCTGAAGAGCGCCCGTGGCTGTGGGTAGTCTATATTCTAACT
GTA
GCCCTTCCTGTGTTCCTGGTTATCCTCTTCTGCTGTTCTGGAAAGAAACAGACCAGTGGTATGGAGT
AT
AAGAAAACTGATGCACCTCAACCGGATGTGAAGGAAGAGGAAGAAGAGAAGGAAGAGGAAAAGGACAA
G
GGAGATGAGGAGGAGGAAGGAGAAGAGAAACTTGAAGAGAAACAGAAAAGTGATGCTGAAGAAGATGGT
GGC
ACTGTCAGTCAAGAGGAGGAAGACAGAAAACCTAAAGCAGAGGAGGATGAAATTTTGAACAGATCAC
CA
AGAAACAGAAAGCCACGAAGAGAGTGA


Translation (592 aa):
MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVY
F
ADSFDRGTLS
GWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFL
F
DTKPLIV
QYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPK
T
GIYEEKHAKRPDADLKTYFTDKKTHLYTL
ILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPE
D
RKPEDWDERPKIPDPEAVKPDD
WDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEW
E
APQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQ
GIWKPRKIPNPDFFEDLEPFRMTPFS
A
IGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAE
PGVVGQMIEAAEERPWLWVVYILT
V
ALPVFLVILFCCSGK
KQTSGMEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDG
G
TVSQEEEDRKPKAE
EDEILNRSPRNRKPRRE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser