NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS39144.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39144.1 Public Mus musculus 5 Cxcl2 23 108 98 CCDS HistoryNCBI Gene:20310Re-query CCDS DB by CCDS ID:39144.1Re-query CCDS DB by GeneID:20310See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 39144.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000075433.7 ENSMUSP00000074885.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000075433.7Link to Ensembl Protein Viewer:ENSMUSP00000074885.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000075433Re-query CCDS DB by Protein ID:ENSMUSP00000074885
Original member Current member NCBI NM_009140.2 NP_033166.1 Accepted alive Link to Nucleotide Sequence:NM_009140.2Link to Protein Sequence:NP_033166.1Re-query CCDS DB by Nucleotide ID:NM_009140Re-query CCDS DB by Protein ID:NP_033166Link to BLAST:NP_033166.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033166.1 100 P10889 100 100% 0 0

Chromosomal Locations for CCDS 39144.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 90903945 90904023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90904116 90904239 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90904357 90904440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 90905189 90905204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (303 nt):
ATGGCCCCTCCCACCTGCCGGCTCCTCAGTGCTGCACTGGTCCTGCTGCTGCTGCTGGCCACCAACCACC
AG
GCTACAGGGGCTGTTGTGGCCAGTGAACTGCGCTGTCAATGCCTGAAGACCCTGCCAAGGGTTGACTT
C
AAGAACATCCAGAGCTTGAGTGTGACGCCCCCAGGACCCCACTGCGCCCAGACAGAAGTCATAGCCACT
CTC
AAGGGCGGTCAAAAAGTTTGCCTTGACCCTGAAGCCCCCCTGGTTCAGAAAATCATCCAAAAGATAC
TG
AACAAAGGCAAGGCTAACTGA


Translation (100 aa):
MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIAT
L
KGGQKVCLDPEAPLVQKIIQKILN
KGKAN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser