NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29849.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29849.1 Public Mus musculus 19 Scd4 23 108 98 CCDS HistoryNCBI Gene:329065Re-query CCDS DB by CCDS ID:29849.1Re-query CCDS DB by GeneID:329065See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29849.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000058856.8 ENSMUSP00000059860.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000058856.8Link to Ensembl Protein Viewer:ENSMUSP00000059860.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000058856Re-query CCDS DB by Protein ID:ENSMUSP00000059860
Original member Current member NCBI NM_183216.3 NP_899039.2 Accepted alive Link to Nucleotide Sequence:NM_183216.3Link to Protein Sequence:NP_899039.2Re-query CCDS DB by Nucleotide ID:NM_183216Re-query CCDS DB by Protein ID:NP_899039Link to BLAST:NP_899039.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_899039.2 353 Q6T707 353 100% 0 0

Chromosomal Locations for CCDS 29849.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 44333492 44333515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44333994 44334261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44337501 44337631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44338910 44339115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44341221 44341453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44344700 44344899 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1062 nt):
ATGACGGCCCACTTGCCACAAGAGATCTCCAGCAGGTGTAGCACTACCAACATCATGGAACCCCACTCCC
GG
AGACAGCAGGATGGAGAAGAGAAGATGCCCCTCCAGGCAGAAGATATCCGGCCTGAAATAAAAGATGA
T
CTGTATGACCCCAGCTACCAGGATGAGGAGGGACCCCCGCCCAAGCTGGAGTACGTCTGGAGGAACATC
ATC
TTCATGGCCCTGCTGCACGTGGGAGCCCTGTACGGGATCACACTGGTTCCCTCCTGCAAGGTCTACA
CC
TGGCTCTTGGGAGTATTCTACAACGTGGTTGCCGGTTTGGGCATCACAGCCGGAGCGCATCGCTTGTG
G
AGCCACCGAACCTATAAAGCAAGGCTGCCCCTACGCATCTTCCTCATCATGGCCAATACCATGGCTTTC
CAG
AATGACGTGTATGAATGGGCCCGAGATCACCGCGCCCACCACAAGTTCTCAGAAACACACGCCGACC
CT
CACAATTCCCGCCGTGGCTTCTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACATCCGGCTGT
C
AAAGAGAAGGGCAAAAACCTGGACATGTCTGACCTGAAAGCCGAGAAGCTGGTGATGTTCCAGAGGAGG
TAC
TACAAGCTAGCTGTCACGCTCATGTTCATCATTCTGCCCACACTGGTACCCTGGTACTTGTGGGGTG
AG
ACTTTTCAACACAGCTTATGCGTCTCGAATTTCCTGCGGTATGCTGTGCTTCTAAACTTCACTTGGCT
G
GTGAACAGTGCGGCCCACCTCTACGGATACCGGCCCTATGACAGGGGCATTGGTGCCCGGGAGAATCCC
TTC
GTTTCAATGGCATCTTTAGGCGAGGGCTTCCACAACTACCATCACACGTTCCCCTACGATTACTCTG
TC
AGTGAGTACCGCTGGCACATCAACTTCACCACGTTTTTCATCGACTGCATGGCTGCCCTGGGCCTGGC
T
TACGACCGGAAGAAAGTATCTAAGGCCGTTGTCTTAGCCAGGATTAAGAGAACTGGAGATGGGAGTCAC
AAG
AGTAGCTGA


Translation (353 aa):
MTAHLPQEISSRCSTTNIMEPHSRRQQDGEEKMPLQAEDIRPEIKDDLYDPSYQDEEGPPPKLEYVWRNI
I
FMALLHVGALYGITLVPSCKVYTWLL
GVFYNVVAGLGITAGAHRLWSHRTYKARLPLRIFLIMANTMAF
Q
NDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGKNLDMSDLKAEKLVMFQRR
Y
YKLAVTLMFIILPTLVPWYLWGETFQHSLCVSNFLRYAVLLNFTWLVNSAAHLYGYRPYDRGIGARENP
F
VSMASL
GEGFHNYHHTFPYDYSVSEYRWHINFTTFFIDCMAALGLAYDRKKVSKAVVLARIKRTGDGSH
K
SS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser