NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS51201.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51201.1 Public Mus musculus 4 Fkbp15 23 108 98 CCDS HistoryNCBI Gene:338355Re-query CCDS DB by CCDS ID:51201.1Re-query CCDS DB by GeneID:338355See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 51201.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000084527.9 ENSMUSP00000081575.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000084527.9Link to Ensembl Protein Viewer:ENSMUSP00000081575.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000084527Re-query CCDS DB by Protein ID:ENSMUSP00000081575
Original member Current member NCBI NM_001045528.2 NP_001038993.1 Accepted alive Link to Nucleotide Sequence:NM_001045528.2Link to Protein Sequence:NP_001038993.1Re-query CCDS DB by Nucleotide ID:NM_001045528Re-query CCDS DB by Protein ID:NP_001038993Link to BLAST:NP_001038993.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001038993.1 1216 Q6P9Q6-1 1216 100% 0 0

Chromosomal Locations for CCDS 51201.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 62300907 62300990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62303161 62303257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62304191 62304906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62305123 62305230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62305910 62306029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62306895 62307047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62307938 62308093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62312258 62312394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62314254 62314425 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62320959 62321061 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62322183 62322277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62323197 62323304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62324112 62324221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62326059 62326173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62327813 62327919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62329348 62329450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62332191 62332298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62333683 62333740 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62334121 62334260 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62336401 62336547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62337057 62337125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62338486 62338635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62340234 62340332 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62340622 62340696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62345508 62345577 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62346057 62346141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62352433 62352545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 62360370 62360422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3651 nt):
ATGTTCGGTGCCGGAGACGAGGATGACACCGACTTCCTCTCGCCAAGCGGCGGAGCTAAGCTGGCTTCTC
TT
TTTGGACTGGATCAAGCAACTATGGGCCATGGAAATGAATTCTTCCAGTACACAGCCCCAAAGCAACC
T
AAGAAAGGCCAGGGAACAGCAGCAGGAAATCAGACAGCACCAAAGCCAGCCCCAGCTACCACAGGCACG
TCC
TCAGTGCTGTTTGCCACTGCAGTGCATGCATACCGCTACATAAATGGTCAATATGCAAAGCAGGGCA
AA
TTTGGAGCGGCTGTCCTGGGGAACCACACAAGCAGAGAGTATAGGATTCTTCTTTACATCAGTCAGCA
G
CAGCCAGTGACTGTTGCTACAATTCATCTGAACTTTGAGCTAATGGTTCGGCCCAATAACTACAGCACC
TTT
TATGATGACCAGAGACAAAACTGGTCTATCATGTTTGAGTCAGAGAAGGCCGCTGTGTCATTCAATA
AA
CAGGTGTGTGTGGCCAAGTGCAATAGCATCTCTTCCTTGGATGCAGTGCTGTGTCAGGACCTGGTTGC
A
GCAGAGGGCCCTGCTGTGGAAACTGGAGATTCTTTAGAAGTAGCCTATACGGGCTGGCTCCTTCAGAAT
CAT
GTGCTGGGCCAGGTTTTTGATTCTACTGCTAACAAAGATAAGCCGCTTCGCCTAAAATTAGGATCAG
GA
AAAGTTGTCAAGGGCTTAGAGGACGGGCTACTGGGCATGAAGAAAGGAGGAAAGCGCTTAATTATCAC
T
CCTTCAGCCTGCGCTGCTGGCTCTGAAGGAGTAATAGGCTGGACTCAGCCAACAGACTCCATCCTGGTG
TTT
GAGGTAGAAGTTAGGCGGGTGAAGTTTGCCAGAGATTCTGGCTCTGATGGCCACAGTGTGAGCTCCC
GG
GATTCTGCAGCCCCTTCCCCCATCCCTGCTTCTGACAGCCTCTCTGCTGATCCTGTTGTGACACCCCT
G
CCATTGCCTCTCAAACCTGGGGAACCGGGTCTTCGTTCCAAATCTAACTCTCTCAGCGAACAGCTAACT
GTA
AATTCAAATCCTGATACGGTCAAGGCCAAGCTGATCTCGAGGATGGCTAAAATGGGCCAGCCCATGC
TA
CCCATCCTTCCGCCACAGCTGGACTCCAATGACTCAGAAACCGAAGATGCAACTGTTCTGCGAGGAGC
T
GGGCAGTCCCTTGTGACACCATCTATCCAGCCTTCTCTTCAGCCAGCTCATCCGGTATTACCACAGATG
GCC
TCACAGGCACCTCAGCCATCTGGTTCTGGGCTCCAGACACCCTCTGCTGCCTTGATGCAAGCTGTGT
CC
CTTGATTCTCACTCGGCTGTATCTGGAAATGCACAGAACTTCCAGCCCTATGCAGGTGTGCAAGCCTA
T
GCATATCCCCAGACACCCTCAGTTACTTCCCAGCTGCAGCCTGTTCGGCCCTTGTACCCAGCACCACTG
TCC
CAGGCTCCCCACTTTCAAGGATCAGGAGACATGATGTCCTTTCTCATGACTGAAGCCCGGCAACACA
AC
ACTGAAATTCGAATGGCAGTCAACAAAGTGGCTGATAAAATGGATCACCTCATGACTAAGGTGGAGGA
G
TTACAGAAGCATAGCTCTGGCAACTCCATGCTTCTTCCTAGCATGTCGGTCACAATGGAAACAAGCATG
ATT
ATGAGCAACATCCAGCGCATCATCCAGGAAAATGAGAGACTGAAGCAGGAGCTCCTTGAGAAAAGCA
GT
CGGATAGAAGAGCAGAATGACAAGATTAGTGACCTCATTGAACGCAACCAGAGATATGTTGAGCAGAG
T
AACCTGATGATGGAGAAGAGGAACAACTCGCTTCAAACAGCCACAGAAAACACACAGGCAAGAATATTG
CAT
GCTGAACAAGAGAAGGCCAAGGTAACAGAAGAGTTAGCAGCAGCTACTGCACAGGTGTCTCACCTGC
AG
CTGAAAATGACGGCTCACCAGAAGAAGGAGACAGAATTGCAGTTGCAGCTGACAGACAACTTGAAGGA
G
ACAGATCTTCTCAGGGGCCACGTCACCAGGCTCCAGGCTGACCTCTCGGAGCTCCGAGAAGCCTCTGAG
CAA
ACACAGACCAAATTCAAAAGTGAAAAGCAGAGCCGGCGGCAGCTGGAGCTCAAGGTAACATCCCTGG
AG
GAAGAGCTGACTGACCTCCGAGCTGAGAAGACCTCCCTTGAAAAGAACCTCTCAGAGAGGAAAAAGAA
G
TCAGCTCAGGAGCGCTGCCAGGCGGAGGCAGAGATGGACGAGATTCGCAAGTCACACCAGGAGGAACTG
GAC
AGACTTCGGCAGCTCTTGAAAAAGGCTCGGGTGTCCACAGACCAAGCAGCTGCAGAGCAGCTGACTC
TT
GCACAGGCTGAGCTGCAGAGCCAGTGGGAGGCTAAGTGTGAGCAGCTTTTGGCCTCTGCAAGAGATGA
A
CACCTGCAGCAATACCGAGAAGTGTGCGCGCAGAGGGATGCCCATCAACAGAAGCTGGCTCTCCTTCAG
GAT
GAGTGCTTAGCTCTCCAGGCCCAGATCGCAGCCTTCACTGAACAGAAGGAACACATGCAGCGACTGG
AG
AAGACTAAGTCCCAGGCACCTGCAGGCAGAGCTGCTGCTGACCCCTCAGAGAAGGTCAAGAAGATCAT
G
AACCAGGTGTTCCAGTCACTGAGGGGAGAGTTTGAGCTGGAGGAATCTTATGATGGAGGGACCATTCTG
AGG
ACCATCATGCATACAATTAAGATGGTGACGCTGCAGCTGTTGAACCATCAGGAGGAAGAGGAGGAAG
AG
GAAGAGGAGGAGGAAGAGGAGAAGAAGCCCCTGAGACCTTCCCTGGAGCAGCCAGGCCCTGCCACCCC
G
GGGATGCCTCCAGCACCCCCAAGTGGGGAGACGCAGGAGGCTCCCGAGGTGCTGCCAGAACAGGTAGTA
GGG
GAGACCACCCCACTGCCTCTACAGGCTCTCCCCACGCCAGAGAATGGTGCACAGACAAGGAAAGGGG
AG
CCCGCAGAAGCGGAGGTACCTTCAGAAATCAAAGACAGTTCTCTCCCACCTCAGCCAGCTGGCATCCC
A
GCTCACAGAGTCCTGGGGCCCCCGACTTCAATCCCACCTAAACCTCCAGGACCTGTAACTATGGACTCT
GAG
TCTGAGGAGATGCTTGCTGCTGACCAGAGAACAGTGCAGCCCAATGGCTTGTTGGGAGAAGAACATG
TC
AGGGAAGTAGCCACAGATGGTCTACTGCAAGGCAACTCCAGGAGATTGTCACTGACTCCAGACCCTGA
G
AAGGGAGAGCCACCAGCCTTAGACCCTGAAAGCCAAGGAGGAGAAGCTCAGCCTCCTGAGTGCAAACAA
GCT
GAGGATGTTAGTAGCTCTGGTCCCCGTGAGACGCTGTTAGACACAGAGCTTGCTTCAGCAGCTGCAG
GG
ACATCCCTCAGGCACAACCAGGACTCCCAGCACTGCAGTCTCTCTGGAGATGAAGAGGACGAGCTGTT
T
AAAGGAGCGACTCTGAAAGTTCCGAGGCCCACAGCCCAGCCTGAGGAGGAGGATGAAGATGAGGTGAGC
ATG
AAGGGACGCCCGCCTCCAACCCCCCTTTTTGGAGACGATGATGATGATGATGACGATGACATTGGCT
GG
CTGGGGTGA


Translation (1216 aa):
MFGAGDEDDTDFLSPSGGAKLASLFGLDQATMGHGNEFFQYTAPKQPKKGQGTAAGNQTAPKPAPATTGT
S
SVLFATAVHAYR
YINGQYAKQGKFGAAVLGNHTSREYRILLYISQQQPVTVATIHLNFELMVRPNNYST
F
YDDQRQNWSIMFESEKAAVSFNKQ
VCVAKCNSISSLDAVLCQDLVAAEGPAVETGDSLEVAYTGWLLQN
H
VLGQ
VFDSTANKDKPLRLKLGSGKVVKGLEDGLLGMKKGGKRLIITPSACAAGSEGVIGWTQPTDSILV
F
EVEVRR
VKFARDSGSDGHSVSSRDSAAPSPIPASDSLSADPVVTPLPLPLKPGEPGLRSKSNSLSEQLT
V
NS
NPDTVKAKLISRMAKMGQPMLPILPPQLDSNDSETEDATVLRGAGQSLVTPSIQPSLQPAHPVLPQM
A
SQ
APQPSGSGLQTPSAALMQAVSLDSHSAVSGNAQNFQPYAGVQAYAYPQTPSVTSQLQPVRPLYPAPL
S
QAPHFQ
GSGDMMSFLMTEARQHNTEIRMAVNKVADKMDHLMTKVEELQKHSSGNSMLLPSMSVTMETSM
I
MSNIQRIIQ
ENERLKQELLEKSSRIEEQNDKISDLIERNQRYVEQSNLMMEKRNNSLQTATENTQARIL
H
AEQEK
AKVTEELAAATAQVSHLQLKMTAHQKKETELQLQLTDNLKETDLLRGHVTRLQADLSELREASE
Q
TQTKFKSEKQSRRQLELKVTSLEEELTDLRAEKTSLEK
NLSERKKKSAQERCQAEAEMDEIRKSHQEEL
D
RLRQLLKKARVSTDQAAAEQ
LTLAQAELQSQWEAKCEQLLASARDEHLQQYREVCAQRDAHQQKLALLQ
D
E
CLALQAQIAAFTEQKEHMQRLEKTKSQAPAGRAAADPSEKVKKIMNQVFQSLRGEFELEESYDGGTIL
R
TIMHTIK
MVTLQLLNHQEEEEEEEEEEEEEKKPLRPSLEQPGPATPGMPPAPPSGETQEAPEVLPEQVV
G
ETTPLPLQALPTPENGAQTRKGEPAEAEVPSEIKDSSLPPQPAGIPAHRVLGPPTSIPPKPPGPVTMDS
E
SEEMLAADQRTVQPNGLLGEEHVREVATDGLLQGNSRRLSLTPDPEKGEPPALDPESQGGEAQPPECKQ
A
EDVSSSGPRETLLDTELASAAAGTSLRHNQDSQHC
SLSGDEEDELFKGATLKVPRPTAQPEEEDEDEVS
M
KGRPPPTPLFGDDDDDDDDDIGWLG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser