NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36257.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36257.1 Public Mus musculus 11 Wfdc17 23 108 98 CCDS HistoryNCBI Gene:100034251Re-query CCDS DB by CCDS ID:36257.1Re-query CCDS DB by GeneID:100034251See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36257.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000092836.5 ENSMUSP00000090511.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092836.5Link to Ensembl Protein Viewer:ENSMUSP00000090511.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000092836Re-query CCDS DB by Protein ID:ENSMUSP00000090511
Original member Current member NCBI NM_001081957.1 NP_001075426.1 Accepted alive Link to Nucleotide Sequence:NM_001081957.1Link to Protein Sequence:NP_001075426.1Re-query CCDS DB by Nucleotide ID:NM_001081957Re-query CCDS DB by Protein ID:NP_001075426Link to BLAST:NP_001075426.1

Chromosomal Locations for CCDS 36257.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 83704092 83704173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 83704794 83704942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (231 nt):
ATGAAGACAGCCACAGTCTTGTTTCTGGTGGCTTTGATCACTGTGGGGATGAACACTACCTATGTAGTGT
CT
TGCCCCAAAGAATTTGAAAAACCTGGAGCTTGTCCCAAGCCTTCACCAGAAAGTGTTGGAATTTGTGT
T
GATCAATGCTCAGGAGATGGATCCTGCCCTGGCAACATGAAGTGCTGTAGCAATAGCTGTGGTCATGTC
TGC
AAAACTCCTGTCTTTTAA


Translation (76 aa):
MKTATVLFLVALITVGMNTTYVVSCPKEFEKPGACPKPSPESVGICVDQCSGDGSCPGNMKCCSNSCGHV
C
KTPVF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser