NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS36187.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
36187.1 Public Mus musculus 11 Rpl26 23 108 98 CCDS HistoryNCBI Gene:19941Re-query CCDS DB by CCDS ID:36187.1Re-query CCDS DB by GeneID:19941See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 36187.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000073471.12 ENSMUSP00000073175.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073471.12Link to Ensembl Protein Viewer:ENSMUSP00000073175.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000073471Re-query CCDS DB by Protein ID:ENSMUSP00000073175
Original member Current member EBI ENSMUST00000167436.2 ENSMUSP00000129072.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167436.2Link to Ensembl Protein Viewer:ENSMUSP00000129072.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000167436Re-query CCDS DB by Protein ID:ENSMUSP00000129072
Original member Current member NCBI NM_009080.2 NP_033106.1 Accepted alive Link to Nucleotide Sequence:NM_009080.2Link to Protein Sequence:NP_033106.1Re-query CCDS DB by Nucleotide ID:NM_009080Re-query CCDS DB by Protein ID:NP_033106Link to BLAST:NP_033106.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033106.1 145 P61255 145 100% 0 0

Chromosomal Locations for CCDS 36187.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 68902275 68902442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68903179 68903319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 68904365 68904493 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (438 nt):
ATGAAGTTCAATCCCTTCGTGACTTCTGACCGAAGCAAGAACCGCAAACGGCATTTCAATGCGCCCTCTC
AC
ATTCGGAGGAAGATCATGTCTTCCCCTCTTTCCAAAGAGCTGAGACAGAAGTATAACGTTCGGTCTAT
G
CCCATTCGGAAGGATGACGAAGTTCAGGTTGTTCGCGGACACTACAAAGGCCAGCAGATTGGCAAGGTG
GTC
CAAGTGTACAGGAAGAAGTACGTCATCTACATCGAACGAGTCCAGCGAGAGAAGGCTAATGGCACAA
CC
GTCCATGTGGGCATCCACCCCAGCAAGGTCGTTATCACCAGGCTAAAGCTGGACAAGGACCGCAAGAA
G
ATCCTGGAGAGGAAAGCCAAGTCCCGACAAGTAGGAAAGGAGAAGGGCAAATACAAGGAAGAAACGATC
GAG
AAGATGCAGGAGTAG


Translation (145 aa):
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKV
V
QVYRKKYVIYIERVQREKANGTTVHVGIHPSK
VVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETI
E
KMQE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser