NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS57456.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57456.1 Public Mus musculus 6 Klrd1 23 108 98 CCDS HistoryNCBI Gene:16643Re-query CCDS DB by CCDS ID:57456.1Re-query CCDS DB by GeneID:16643See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57456.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000112063.8 ENSMUSP00000107694.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000112063.8Link to Ensembl Protein Viewer:ENSMUSP00000107694.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000112063Re-query CCDS DB by Protein ID:ENSMUSP00000107694
Original member Current member NCBI NM_010654.4 NP_034784.1 Accepted alive Link to Nucleotide Sequence:NM_010654.4Link to Protein Sequence:NP_034784.1Re-query CCDS DB by Nucleotide ID:NM_010654Re-query CCDS DB by Protein ID:NP_034784Link to BLAST:NP_034784.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034784.1 179 O54707 179 100% 0 0

Chromosomal Locations for CCDS 57456.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 129591831 129591837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129593490 129593582 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129593728 129593790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129595410 129595561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129596862 129596965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 129598349 129598469 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (540 nt):
ATGGCAGTTTCTAGGATCACTCGGTGGAGACTGATGTCTGTCATCTTTGGAATAAAATGTCTTTTCTTGA
TG
GTTACTTTGGGAGTTTTGCTGATAAATTCATTTACTATACAGAACATTCAATCAACACCTTCTCCAAC
C
ACCACTGTAGAATTCCAGGAAGTTTCTGAATGCTGTGTTTGCCTGGACAAGTGGGTTGGGCATCAGTGC
AAT
TGTTACTTTATTTCCAAAGAAGAAAAGTCTTGGAAAAGAAGCAGAGATTTCTGTGCTTCGCAGAATT
CC
AGCCTTCTTCAGCCCCAATCCAGAAATGAATTGAGTTTTATGAACTTCAGTCAAACCTTTTTCTGGAT
T
GGAATGCATTATAGTGAAAAAAGAAATGCCTGGCTATGGGAGGATGGCACAGTTCCCTCAAAAGATTTA
TTT
CCAGAATTCTCAGTTATCAGGCCAGAGCACTGCATTGTTTACAGTCCAAGCAAAAGCGTTTCTGCTG
AA
TCCTGTGAAAATAAAAACCGTTACATCTGTAAGAAACTGCCTATTTAA


Translation (179 aa):
MAVSRITRWRLMSVIFGIKCLFLMVTLGVLLINSFTIQNIQSTPSPTTTVEFQEVSECCVCLDKWVGHQC
N
CYFISKEEKSWKRSRDFCASQNSSLLQPQSRNEL
SFMNFSQTFFWIGMHYSEKRNAWLWEDGTVPSKDL
F
PEFSVIRPEHCIVYSPSKSVSAESCENKNRYICKKLPI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser