NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26782.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26782.1 Public Mus musculus 13 Gzma 23 108 98 CCDS HistoryNCBI Gene:14938Re-query CCDS DB by CCDS ID:26782.1Re-query CCDS DB by GeneID:14938See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26782.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023897.6 ENSMUSP00000023897.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023897.6Link to Ensembl Protein Viewer:ENSMUSP00000023897.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000023897Re-query CCDS DB by Protein ID:ENSMUSP00000023897
Original member Current member NCBI NM_010370.3 NP_034500.1 Accepted alive Link to Nucleotide Sequence:NM_010370.3Link to Protein Sequence:NP_034500.1Re-query CCDS DB by Nucleotide ID:NM_010370Re-query CCDS DB by Protein ID:NP_034500Link to BLAST:NP_034500.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034500.1 260 P11032-1 260 100% 0 0

Chromosomal Locations for CCDS 26782.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 113093892 113094050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 113095751 113096020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 113096203 113096341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 113098241 113098385 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 113100882 113100951 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (783 nt):
ATGAGGAACGCCTCTGGTCCCCGGGGGCCATCTCTTGCTACTCTCCTTTTTCTTCTGCTTATTCCTGAAG
GA
GGCTGTGAAAGAATCATTGGAGGAGACACGGTTGTTCCTCACTCAAGACCGTATATGGCTCTACTTAA
A
CTTAGTTCAAATACCATCTGTGCTGGCGCTTTGATTGAAAAGAACTGGGTGTTGACTGCTGCCCACTGT
AAC
GTGGGAAAGAGATCTAAGTTCATTCTTGGGGCTCACTCAATCAATAAGGAGCCAGAACAACAGATAT
TG
ACTGTTAAGAAAGCATTTCCCTATCCATGCTATGATGAATATACACGTGAGGGGGATCTACAACTTGT
A
CGGCTAAAGAAAAAAGCAACAGTTAACAGAAATGTGGCTATCCTTCACCTACCTAAAAAGGGAGATGAT
GTG
AAACCAGGAACCAGATGCCGAGTAGCAGGATGGGGGAGATTTGGCAATAAGTCAGCTCCCTCTGAAA
CT
CTGAGAGAAGTCAACATCACTGTCATAGACAGAAAAATCTGCAATGATGAAAAACACTATAATTTTCA
T
CCTGTAATTGGACTAAACATGATTTGTGCAGGGGACCTCCGTGGTGGAAAGGACTCCTGCAATGGGGAT
TCT
GGCAGCCCTCTGCTATGTGATGGTATTTTGCGAGGCATCACCTCTTTTGGTGGAGAGAAGTGTGGAG
AT
CGCCGATGGCCTGGTGTCTATACTTTCCTCTCAGATAAACACCTCAATTGGATAAAGAAGATTATGAA
G
GGTTCTGTGTAA


Translation (260 aa):
MRNASGPRGPSLATLLFLLLIPEGGCERIIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHC
N
VGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDD
V
KPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCN
GD
S
GSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser