NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS26689.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26689.1 Public Mus musculus 13 Bhmt2 23 108 98 CCDS HistoryNCBI Gene:64918Re-query CCDS DB by CCDS ID:26689.1Re-query CCDS DB by GeneID:64918See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 26689.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000015941.7 ENSMUSP00000015941.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000015941.7Link to Ensembl Protein Viewer:ENSMUSP00000015941.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000015941Re-query CCDS DB by Protein ID:ENSMUSP00000015941
Original member Current member NCBI NM_022884.2 NP_075022.2 Accepted alive Link to Nucleotide Sequence:NM_022884.2Link to Protein Sequence:NP_075022.2Re-query CCDS DB by Nucleotide ID:NM_022884Re-query CCDS DB by Protein ID:NP_075022Link to BLAST:NP_075022.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_075022.2 363 Q91WS4 363 100% 0 0

Chromosomal Locations for CCDS 26689.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 93657063 93657144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93662302 93662530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93663146 93663328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93663674 93663821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93666574 93666765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93669255 93669346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93671413 93671545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 93674238 93674270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1092 nt):
ATGGCACCAGCTGGAAGCACTCGAGCCAAGAAGGGCATCTTGGAGCGTCTGGACAGCGGGGAGGTGGTGG
TT
GGGGACAGCGGCTTTCTCTTCACTCTGGAAAAGAGAGGCTTCGTGAAGGCGGGGCTTTGGACTCCAGA
A
GCAGTGGTAGAACATCCAAGTGCAGTTCGTCAACTTCACACAGAATTCTTGAGAGCGGGAGCTGATGTC
TTG
CAGACATTCACCTTTTCTGCTACTGAAGACAATATGGCCAGCAAGTGGGAAGCTGTGAATGCAGCTG
CC
TGTGACCTGGCCCAGGAGGTGGCTGGTGGAGGGGGTGCTTTGGTGGCAGGGGGCATCTGCCAGACATC
A
CTCTACAAGTACCACAAGGATGAAACTAGAATTAAAAACATTTTTCGACTACAGCTAGAAGTTTTTGCC
AGG
AAAAATGTGGACTTCTTGATTGCAGAGTATTTTGAGCATGTGGAAGAAGCTGTATGGGCTGTCGAAG
TC
TTGAGAGAGGTGGGGGCACCTGTGGCTGTGACCATGTGCATCGGCCCAGAGGGGGACATGCACGACGT
G
ACACCTGGAGAGTGTGCGGTGAAGCTGGCGCGTGCAGGGGCGGACATCATTGGGGTCAACTGCCGGTTT
GGG
CCCTGGACTAGCTTGCAGACCATGAAGCTCATGAAAGAGGGCCTCAGAGATGCCAGCCTGCAGGCTC
AC
CTTATGGTCCAGTGCTTGGGCTTCCACACACCGGACTGTGGCAAGGGAGGGTTTGTGGACCTCCCAGA
G
TATCCCTTTGGCCTGGAGCCAAGAGTTGCCACCAGATGGGATATTCAAAAATACGCCAGAGAGGCCTAC
AAC
CTGGGGATCAGGTACATTGGCGGCTGCTGCGGATTTGAGCCCTACCACATCAGGGCGATTGCAGAGG
AA
CTGGCCCCAGAAAGGGGATTTTTGCCACCGGCTTCAGAGAAACATGGCAGCTGGGGAAGTGGTCTGAA
C
ATGCACACCAAACCCTGGATCAGAGCAAGGGCTAGACGAGAATACTGGGAGAATCTGCTGCCAGCCTCA
GGA
AGACCTTTCTGTCCTTCCCTATCAAAGCCAGATGCATAA


Translation (363 aa):
MAPAGSTRAKKGILERLDSGEVVVGDSGFLFTLEKRGFVKAGLWTPEAVVEHPSAVRQLHTEFLRAGADV
L
QTFTFSATEDNMASK
WEAVNAAACDLAQEVAGGGGALVAGGICQTSLYKYHKDETRIKNIFRLQLEVFA
R
KNVDFLIAE
YFEHVEEAVWAVEVLREVGAPVAVTMCIGPEGDMHDVTPGECAVKLARAGADIIGVNCRF
G
PWTSLQTMKLMKEGLRDASLQAHLMVQCLGFHTPDCGKGGFVDLPEYPF
GLEPRVATRWDIQKYAREAY
N
LGIRYIGGCCGFEPYHIRAIAEELAPERGFLPPASEKHGSWGSGLNMHTKPWIRA
RARREYWENLLPAS
G
RPFCPSLSKPDA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser