NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS21008.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
21008.1 Public Mus musculus 7 Cyp2a5 23 108 98 CCDS HistoryNCBI Gene:13087Re-query CCDS DB by CCDS ID:21008.1Re-query CCDS DB by GeneID:13087See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 21008.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000005685.14 ENSMUSP00000005685.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000005685.14Link to Ensembl Protein Viewer:ENSMUSP00000005685.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000005685Re-query CCDS DB by Protein ID:ENSMUSP00000005685
Original member Current member NCBI NM_007812.4 NP_031838.2 Accepted alive Link to Nucleotide Sequence:NM_007812.4Link to Protein Sequence:NP_031838.2Re-query CCDS DB by Nucleotide ID:NM_007812Re-query CCDS DB by Protein ID:NP_031838Link to BLAST:NP_031838.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031838.2 494 P20852 494 99.7976% 0 1

Chromosomal Locations for CCDS 21008.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 26835364 26835543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26835795 26835957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26836675 26836824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26837091 26837251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26838868 26839044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26840360 26840501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26840937 26841124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26841728 26841869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 26842878 26843059 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1485 nt):
ATGCTGACCTCAGGACTCCTCCTGGTGGCTGCAGTGGCCTTCCTCAGCGTCCTGGTCTTGATGTCTGTCT
GG
AAGCAGAGAAAGCTCTCAGGAAAGCTGCCTCCAGGACCCACCCCACTGCCCTTCATTGGGAACTTCCT
T
CAGCTGAACACAGAGCAAATGTACAACTCTCTCATGAAGATCAGCCAACGTTATGGTCCTGTATTCACC
ATC
TACCTGGGACCTCGCCGAATTGTGGTGCTGTGCGGACAGGAGGCAGTCAAGGAAGCTCTGGTGGACC
AA
GCTGAGGAATTCAGCGGGCGGGGCGAGCAAGCTACCTTCGACTGGCTTTTCAAAGGCTATGGCGTAGC
C
TTCAGCAGCGGGGAGCGAGCCAAACAGCTAAGGCGCTTCTCCATCGCCACGCTGCGGGACTTCGGCGTG
GGG
AAGCGTGGCATCGAGGAGCGCATCCAAGAGGAGGCGGGCTTTCTCATCGATTCATTTCGGAAGACGA
AC
GGTGCTTTTATTGACCCCACCTTCTACCTTAGCCGAACAGTCTCCAATGTCATTAGCTCAATTGTCTT
C
GGGGACCGCTTTGACTATGAGGACAAAGAGTTCCTGTCACTGCTTCGAATGATGCTGGGAAGCTTCCAG
TTC
ACTGCTACCTCCATGGGGCAGCTCTATGAGATGTTCTCTTCTGTGATGAAACACCTGCCAGGGCCCC
AG
CAACAGGCCTTTAAGGAGCTGCAGGGCCTGGAGGACTTCATAACCAAGAAAGTGGAACACAATCAGCG
C
ACGCTGGATCCCAATTCCCCAAGGGACTTCATCGACTCCTTCCTCATCCGAATGCTGGAGGAGAAGAAG
AAC
CCCAATACTGAGTTCTACATGAAGAACTTGGTGCTGACTACACTAAATCTCTTCTTTGCTGGCACAG
AG
ACCGTCAGCACCACCCTGCGCTATGGCTTTCTGTTGCTCATGAAGCACCCAGATATTGAGGCCAAGGT
C
CATGAGGAGATTGATCGGGTGATTGGCAGGAACCGGCAGCCCAAGTATGAGGACCGAATGAAGATGCCC
TAT
ACGGAGGCTGTAATCCATGAGATCCAGAGATTTGCAGACATGATCCCCATGGGCCTGGCTCGAAGGG
TC
ACCAAGGACACCAAGTTTCGAGATTTCCTCCTCCCCAAGGGTACTGAAGTGTTTCCTATGCTGGGCTC
T
GTGCTGAAAGACCCCAAGTTCTTCTCCAACCCCAAAGACTTCAACCCAAAGCACTTCCTAGATGACAAG
GGA
CAGTTTAAGAAGAATGATGCCTTTGTGCCCTTTTCCATTGGAAAACGGTATTGTTTCGGAGAAGGAC
TG
GCTAGGATGGAACTCTTCCTCTTCCTCACAAACATCATGCAGAACTTCCACTTCAAATCCACACAGGC
A
CCCCAGGACATCGATGTGTCTCCTAGACTCGTGGGCTTTGCCACGATCCCACCAACCTACACTATGAGT
TTC
TTGTCCCGTTGA


Translation (494 aa):
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFIGNFLQLNTEQMYNSLMKISQRYGPVFT
I
YLGPRRIVVLCGQEAVKEALVDQAEEFSGRGEQATFDWLFKGY
GVAFSSGERAKQLRRFSIATLRDFGV
G
KRGIEERIQEEAGFLIDSFRKTN
GAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQ
F
TATSMGQ
LYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKK
N
PNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKHPDIE
AKVHEEIDRVIGRNRQPKYEDRMKMP
Y
TEAVIHEIQRFADMIPMGLARRVTKDTKFRDFLLPK
GTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDK
G
QFKKNDAFVPFSI
GKRYCFGEGLARMELFLFLTNIMQNFHFKSTQAPQDIDVSPRLVGFATIPPTYTMS
F
LSR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser