NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48694.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48694.1 Public Mus musculus 10 Lyz2 23 108 98 CCDS HistoryNCBI Gene:17105Re-query CCDS DB by CCDS ID:48694.1Re-query CCDS DB by GeneID:17105See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 48694.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000092163.8 ENSMUSP00000089801.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000092163.8Link to Ensembl Protein Viewer:ENSMUSP00000089801.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000092163Re-query CCDS DB by Protein ID:ENSMUSP00000089801
Original member Current member NCBI NM_017372.3 NP_059068.1 Accepted alive Link to Nucleotide Sequence:NM_017372.3Link to Protein Sequence:NP_059068.1Re-query CCDS DB by Nucleotide ID:NM_017372Re-query CCDS DB by Protein ID:NP_059068Link to BLAST:NP_059068.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_059068.1 148 P08905 148 100% 0 0

Chromosomal Locations for CCDS 48694.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 117278121 117278187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 117278643 117278721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 117280641 117280805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 117282107 117282242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (447 nt):
ATGAAGACTCTCCTGACTCTGGGACTCCTCCTGCTTTCTGTCACTGCTCAGGCCAAGGTCTATGAACGTT
GT
GAGTTTGCCAGAACTCTGAAAAGGAATGGAATGGCTGGCTACTATGGAGTCAGCCTGGCCGACTGGGT
G
TGTTTAGCTCAGCACGAGAGCAATTATAACACACGAGCTACAAACTACAACCGTGGAGACCAAAGCACT
GAC
TATGGGATATTTCAGATCAATAGCCGATACTGGTGTAATGATGGCAAAACCCCAAGAGCTGTGAATG
CC
TGTGGGATCAATTGCAGTGCTCTGCTGCAGGATGACATCACTGCAGCCATACAATGTGCAAAGAGGGT
G
GTGAGAGATCCCCAAGGCATTCGAGCATGGGTGGCATGGCGAGCACACTGTCAAAACCGAGATCTGTCC
CAG
TATATTCGGAACTGCGGAGTCTGA


Translation (148 aa):
MKTLLTLGLLLLSVTAQAKVYERCEFARTLKRNGMAGYYGVSLADWVCLAQHESNYNTRATNYNRGDQST
D
YGIFQINSRYWCNDGKTPRAVNACGINCS
ALLQDDITAAIQCAKRVVRDPQGIRAWVAWRAHCQNRDLS
Q
YIRNCGV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser