NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS632.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
632.1 Public Homo sapiens 1 PDE4B 22 109 92 CCDS HistoryNCBI Gene:5142Re-query CCDS DB by CCDS ID:632.1Re-query CCDS DB by GeneID:5142See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 632.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000329654.8 ENSP00000332116.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000329654.8Link to Ensembl Protein Viewer:ENSP00000332116.4Re-query CCDS DB by Nucleotide ID:ENST00000329654Re-query CCDS DB by Protein ID:ENSP00000332116
Original member Current member EBI ENST00000341517.8 ENSP00000342637.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000341517.8Link to Ensembl Protein Viewer:ENSP00000342637.4Re-query CCDS DB by Nucleotide ID:ENST00000341517Re-query CCDS DB by Protein ID:ENSP00000342637
Original member NCBI NM_001037341.1 NP_001032418.1 Updated not alive Link to Nucleotide Sequence:NM_001037341.1Link to Protein Sequence:NP_001032418.1Re-query CCDS DB by Nucleotide ID:NM_001037341Re-query CCDS DB by Protein ID:NP_001032418
Current member NCBI NM_001037341.2 NP_001032418.1 Accepted alive Link to Nucleotide Sequence:NM_001037341.2Link to Protein Sequence:NP_001032418.1Re-query CCDS DB by Nucleotide ID:NM_001037341Re-query CCDS DB by Protein ID:NP_001032418Link to BLAST:NP_001032418.1
Original member NCBI NM_002600.3 NP_002591.2 Updated not alive Link to Nucleotide Sequence:NM_002600.3Link to Protein Sequence:NP_002591.2Re-query CCDS DB by Nucleotide ID:NM_002600Re-query CCDS DB by Protein ID:NP_002591
Current member NCBI NM_002600.4 NP_002591.2 Accepted alive Link to Nucleotide Sequence:NM_002600.4Link to Protein Sequence:NP_002591.2Re-query CCDS DB by Nucleotide ID:NM_002600Re-query CCDS DB by Protein ID:NP_002591Link to BLAST:NP_002591.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001032418.1 736 Q07343-1 736 100% 0 0
NP_002591.2 736 Q07343-1 736 100% 0 0

Chromosomal Locations for CCDS 632.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 65913315 65913356 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 65918597 65918835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66247460 66247654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66257647 66257683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66257793 66257863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66266038 66266087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66332508 66332620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66355527 66355620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66361615 66361793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66363168 66363266 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66363407 66363571 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66365667 66365766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66367696 66367850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66367943 66368065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66368787 66368969 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 66372313 66372678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2211 nt):
ATGAAGAAAAGCAGGAGTGTGATGACGGTGATGGCTGATGATAATGTTAAAGATTATTTTGAATGTAGCT
TG
AGTAAATCCTACAGTTCTTCCAGTAACACACTTGGGATCGACCTCTGGAGAGGGAGAAGGTGTTGCTC
A
GGAAACTTACAGTTACCACCACTGTCTCAAAGACAGAGTGAAAGGGCAAGGACTCCTGAGGGAGATGGT
ATT
TCCAGGCCGACCACACTGCCTTTGACAACGCTTCCAAGCATTGCTATTACAACTGTAAGCCAGGAGT
G
C
TTTGATGTGGAAAATGGCCCTTCCCCAGGTCGGAGTCCACTGGATCCCCAGGCCAGCTCTTCCGCTGG
G
CTGGTACTTCACGCCACCTTTCCTGGGCACAGCCAGCGCAGAGAGTCATTTCTCTACAGATCAGACAGC
GAC
TATGACTTGTCACCAAAGGCGATGTCGAGAAACTCTTCTCTTCCAAGCGAGCAACACGGCGATGACT
TG
ATTGTAACTCCTTTTGCCCAGGTCCTTGCCAGCTTGCGAAGTGTGAGAAACAACTTCACTATACTGAC
A
AACCTTCATGGTACATCTAACAAGAGGTCCCCAGCTGCTAGTCAGCCTCCTGTCTCCAGAGTCAACCCA
CAA
GAAGAATCTTATCAAAAATTAGCAATGGAAACGCTGGAGGAATTAGACTGGTGTTTAGACCAGCTAG
AG
ACCATACAGACCTACCGGTCTGTCAGTGAGATGGCTTCTAACAAGTTCAAAAGAATGCTGAACCGGGA
G
CTGACACACCTCTCAGAGATGAGCCGATCAGGGAACCAGGTGTCTGAATACATTTCAAATACTTTCTTA
G
AC
AAGCAGAATGATGTGGAGATCCCATCTCCTACCCAGAAAGACAGGGAGAAAAAGAAAAAGCAGCAGC
TC
ATGACCCAGATAAGTGGAGTGAAGAAATTAATGCATAGTTCAAGCCTAAACAATACAAGCATCTCACG
C
TTTGGAGTCAACACTGAAAATGAAGATCACCTGGCCAAGGAGCTGGAAGACCTGAACAAATGGGGTCTT
AAC
ATCTTTAATGTGGCTGGATATTCTCACAATAGACCCCTAACATGCATCATGTATGCTATATTCCAGG
AA
AGAGACCTCCTAAAGACATTCAGAATCTCATCTGACACATTTATAACCTACATGATGACTTTAGAAGA
C
CATTACCATTCTGACGTGGCATATCACAACAGCCTGCACGCTGCTGATGTAGCCCAGTCGACCCATGTT
CTC
CTTTCTACACCAGCATTAGACGCTGTCTTCACAGATTTGGAGATCCTGGCTGCCATTTTTGCAGCTG
CC
ATCCATGACGTTGATCATCCTGGAGTCTCCAATCAGTTTCTCATCAACACAAATTCAGAACTTGCTTT
G
ATGTATAATGATGAATCTGTGTTGGAAAATCATCACCTTGCTGTGGGTTTCAAACTGCTGCAAGAAGAA
CAC
TGTGACATCTTCATGAATCTCACCAAGAAGCAGCGTCAGACACTCAGGAAGATGGTTATTGACATGG
TG
TTAGCAACTGATATGTCTAAACATATGAGCCTGCTGGCAGACCTGAAGACAATGGTAGAAACGAAGAA
A
GTTACAAGTTCAGGCGTTCTTCTCCTAGACAACTATACCGATCGCATTCAGGTCCTTCGCAACATGGTA
CAC
TGTGCAGACCTGAGCAACCCCACCAAGTCCTTGGAATTGTATCGGCAATGGACAGACCGCATCATGG
AG
GAATTTTTCCAGCAGGGAGACAAAGAGCGGGAGAGGGGAATGGAAATTAGCCCAATGTGTGATAAACA
C
ACAGCTTCTGTGGAAAAATCCCAGGTTGGTTTCATCGACTACATTGTCCATCCATTGTGGGAGACATGG
GCA
GATTTGGTACAGCCTGATGCTCAGGACATTCTCGATACCTTAGAAGATAACAGGAACTGGTATCAGA
GC
ATGATACCTCAAAGTCCCTCACCACCACTGGACGAGCAGAACAGGGACTGCCAGGGTCTGATGGAGAA
G
TTTCAGTTTGAACTGACTCTCGATGAGGAAGATTCTGAAGGACCTGAGAAGGAGGGAGAGGGACACAGC
TAT
TTCAGCAGCACAAAGACGCTTTGTGTGATTGATCCAGAAAACAGAGATTCCCTGGGAGAGACTGACA
TA
GACATTGCAACAGAAGACAAGTCCCCCGTGGATACATAA


Translation (736 aa):
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQSERARTPEGDG
I
SRPTTLPLTTLPSIAITTVSQE
CFDVENGPSPGRSPLDPQASSSAGLVLHATFPGHSQRRESFLYRSDS
D
YDLSPKAMSRNSSLPSE
QHGDDLIVTPFAQVLASLRSVRNNFTILTNLHGTSNKRSPAASQPPVSRVNP
Q
EESYQKLAMETLEELDWCLDQLETIQTYRSVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFL
D
KQNDVEIPSPTQKDREKKKKQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGL
N
IFNVAGYSHNRPLTCIMYAIFQ
ERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
L
LSTPALD
AVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEE
H
CDIFMNLTKKQRQTLRKMVIDM
VLATDMSKHMSLLADLKTMVETKKVTSSGVLLLDNYTDRIQVLRNMV
H
CADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEISPMCDKHTASVEKSQ
VGFIDYIVHPLWETW
A
DLVQPDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHS
Y
FSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser