NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8325.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8325.1 Public Homo sapiens 11 DCUN1D5 22 109 92 CCDS HistoryNCBI Gene:84259Re-query CCDS DB by CCDS ID:8325.1Re-query CCDS DB by GeneID:84259See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8325.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000260247.9 ENSP00000260247.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260247.9Link to Ensembl Protein Viewer:ENSP00000260247.5Re-query CCDS DB by Nucleotide ID:ENST00000260247Re-query CCDS DB by Protein ID:ENSP00000260247
Original member NCBI NM_032299.3 NP_115675.1 Updated not alive Link to Nucleotide Sequence:NM_032299.3Link to Protein Sequence:NP_115675.1Re-query CCDS DB by Nucleotide ID:NM_032299Re-query CCDS DB by Protein ID:NP_115675
Current member NCBI NM_032299.4 NP_115675.1 Accepted alive Link to Nucleotide Sequence:NM_032299.4Link to Protein Sequence:NP_115675.1Re-query CCDS DB by Nucleotide ID:NM_032299Re-query CCDS DB by Protein ID:NP_115675Link to BLAST:NP_115675.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_115675.1 237 Q9BTE7 237 100% 0 0

Chromosomal Locations for CCDS 8325.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 103062359 103062414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103064275 103064377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103066269 103066373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103066459 103066567 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103082748 103082839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103083256 103083326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103089227 103089318 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 103091787 103091872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (714 nt):
ATGCCGGTGAAGAAGAAGAGAAAATCCCCTGGGGTGGCAGCAGCAGTAGCGGAAGACGGAGGCCTCAAAA
AG
TGTAAAATCTCCAGCTATTGCAGATCCCAACCCCCTGCTAGACTAATAAGTGGAGAGGAACATTTTTC
A
AGCAAGAAGTGCCTGGCTTGGTTTTATGAATATGCAGGTCCTGATGAAGTTGTAGGGCCAGAAGGAATG
GAA
AAATTTTGTGAAGACATTGGTGTTGAACCTGAAAATATTATTATGTTAGTTTTAGCGTGGAAATTGG
AG
GCTGAAAGCATGGGATTTTTTACCAAGGAAGAATGGTTAAAGGGAATGACTTCATTACAGTGTGACTG
C
ACAGAAAAGTTACAAAACAAATTTGACTTTTTGCGCTCACAGTTGAATGATATTTCGTCATTTAAGAAT
ATC
TACAGATATGCCTTTGATTTTGCAAGGGATAAAGATCAGAGAAGCCTTGATATTGATACTGCTAAAT
CT
ATGTTAGCTCTTCTGCTTGGGAGGACATGGCCACTGTTTTCAGTATTTTACCAGTACCTGGAGCAATC
A
AAGTATCGTGTTATGAACAAAGATCAATGGTACAATGTATTAGAATTCAGCAGAACAGTCCATGCTGAT
CTT
AGTAACTATGATGAAGATGGTGCTTGGCCTGTTCTTCTTGATGAATTTGTTGAGTGGCAAAAAGTCC
GT
CAGACATCATAG


Translation (237 aa):
MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM
E
KFCEDIGVEPEN
IIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN
I
YRYAFDFAR
DKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
L
SNYDEDGA
WPVLLDEFVEWQKVRQTS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser