NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS9172.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9172.1 Public Homo sapiens 12 RBM19 22 109 92 CCDS HistoryNCBI Gene:9904Re-query CCDS DB by CCDS ID:9172.1Re-query CCDS DB by GeneID:9904See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9172.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000261741.9 ENSP00000261741.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261741.9Link to Ensembl Protein Viewer:ENSP00000261741.5Re-query CCDS DB by Nucleotide ID:ENST00000261741Re-query CCDS DB by Protein ID:ENSP00000261741
Original member Current member EBI ENST00000392561.7 ENSP00000376344.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392561.7Link to Ensembl Protein Viewer:ENSP00000376344.3Re-query CCDS DB by Nucleotide ID:ENST00000392561Re-query CCDS DB by Protein ID:ENSP00000376344
Original member Current member EBI ENST00000545145.6 ENSP00000442053.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545145.6Link to Ensembl Protein Viewer:ENSP00000442053.2Re-query CCDS DB by Nucleotide ID:ENST00000545145Re-query CCDS DB by Protein ID:ENSP00000442053
Original member NCBI NM_001146698.1 NP_001140170.1 Updated not alive Link to Nucleotide Sequence:NM_001146698.1Link to Protein Sequence:NP_001140170.1Re-query CCDS DB by Nucleotide ID:NM_001146698Re-query CCDS DB by Protein ID:NP_001140170
Current member NCBI NM_001146698.2 NP_001140170.1 Accepted alive Link to Nucleotide Sequence:NM_001146698.2Link to Protein Sequence:NP_001140170.1Re-query CCDS DB by Nucleotide ID:NM_001146698Re-query CCDS DB by Protein ID:NP_001140170Link to BLAST:NP_001140170.1
Original member NCBI NM_001146699.1 NP_001140171.1 Updated not alive Link to Nucleotide Sequence:NM_001146699.1Link to Protein Sequence:NP_001140171.1Re-query CCDS DB by Nucleotide ID:NM_001146699Re-query CCDS DB by Protein ID:NP_001140171
Current member NCBI NM_001146699.2 NP_001140171.1 Accepted alive Link to Nucleotide Sequence:NM_001146699.2Link to Protein Sequence:NP_001140171.1Re-query CCDS DB by Nucleotide ID:NM_001146699Re-query CCDS DB by Protein ID:NP_001140171Link to BLAST:NP_001140171.1
Original member NCBI NM_016196.3 NP_057280.2 Updated not alive Link to Nucleotide Sequence:NM_016196.3Link to Protein Sequence:NP_057280.2Re-query CCDS DB by Nucleotide ID:NM_016196Re-query CCDS DB by Protein ID:NP_057280
Current member NCBI NM_016196.4 NP_057280.2 Accepted alive Link to Nucleotide Sequence:NM_016196.4Link to Protein Sequence:NP_057280.2Re-query CCDS DB by Nucleotide ID:NM_016196Re-query CCDS DB by Protein ID:NP_057280Link to BLAST:NP_057280.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001140170.1 960 Q9Y4C8 960 100% 0 0
NP_001140171.1 960 Q9Y4C8 960 100% 0 0
NP_057280.2 960 Q9Y4C8 960 100% 0 0

Chromosomal Locations for CCDS 9172.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 113823224 113823321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113844668 113844788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113858791 113858896 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113914969 113915085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113918392 113918447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113920611 113920690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113924697 113924757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113927054 113927229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113937007 113937136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113939960 113940160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113942324 113942434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113945828 113945924 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113946354 113946475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113947334 113947464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113948833 113949036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113950083 113950154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113952512 113952590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113955131 113955211 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113957782 113958050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113959212 113959404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113959865 113959903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113960059 113960178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113962232 113962414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 113966192 113966227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2883 nt):
ATGTCGCGACTGATCGTGAAGAATCTCCCGAATGGGATGAAGGAGGAGCGTTTCAGGCAGCTGTTTGCCG
CC
TTCGGCACGCTGACAGACTGCAGCCTGAAGTTCACCAAAGATGGCAAGTTCCGCAAGTTTGGTTTTAT
T
GGCTTCAAGTCCGAGGAAGAGGCCCAGAAGGCACAGAAGCATTTCAACAAGAGCTTCATCGACACATCC
CGG
ATCACAGTGGAGTTCTGCAAGTCATTCGGGGACCCGGCCAAACCCAGAGCCTGGAGCAAACATGCCC
AG
AAACCAAGCCAGCCCAAGCAGCCTCCAAAAGACTCTACTACTCCAGAAATTAAGAAAGATGAGAAGAA
G
AAAAAGGTGGCAGGTCAACTGGAGAAGCTGAAGGAGGATACAGAGTTCCAGGAGTTTCTGTCAGTTCAT
CAG
AGGCGGGCGCAGGCAGCCACTTGGGCGAATGATGGCCTGGATGCTGAGCCCTCGAAAGGGAAGAGCA
AG
CCGGCCAGTGACTACCTGAACTTCGACTCCGATTCTGGGCAGGAGAGTGAGGAGGAGGGAGCCGGGGA
G
GACCTGGAAGAAGAGGCAAGCCTCGAACCAAAGGCAGCTGTGCAGAAGGAGCTGTCGGACATGGATTAC
CTG
AAATCCAAGATGGTGAAGGCTGGGTCGTCCTCTTCCTCGGAGGAAGAGGAAAGTGAAGATGAAGCCG
TG
CACTGTGATGAAGGGAGTGAGGCCGAGGAAGAGGATTCCTCCGCCACCCCAGTCCTGCAGGAAAGAGA
C
AGCAAGGGTGCAGGCCAAGAGCAAGGGATGCCAGCTGGGAAAAAGAGACCACCGGAGGCCAGAGCCGAG
ACA
GAGAAACCAGCAAACCAGAAGGAACCCACCACCTGCCACACCGTGAAGCTGCGGGGAGCCCCGTTCA
AT
GTCACAGAGAAAAATGTTATGGAATTCCTGGCACCCCTGAAACCAGTGGCCATTCGAATTGTGAGAAA
C
GCTCATGGGAATAAAACAGGATACATCTTTGTGGATTTCAGCAATGAAGAGGAAGTGAAGCAAGCTCTG
AAA
TGCAACCGGGAGTACATGGGTGGGCGCTACATCGAGGTGTTCAGGGAAAAGAACGTCCCCACCACCA
AG
GGTGCACCAAAGAATACCACCAAATCCTGGCAAGGCCGGATACTCGGGGAGAACGAAGAGGAGGAGGA
C
CTGGCCGAATCCGGAAGGCTCTTTGTACGGAACCTGCCCTACACCAGCACCGAGGAGGATCTGGAGAAG
CTC
TTCTCCAAATATGGTCCCCTGTCTGAGCTCCACTACCCCATCGACAGCCTGACCAAGAAACCCAAGG
GT
TTTGCATTCATCACCTTCATGTTCCCTGAGCACGCTGTGAAGGCCTACTCGGAGGTGGACGGGCAGGT
A
TTCCAGGGCAGGATGCTCCACGTGTTACCATCTACCATCAAGAAGGAAGCCAGCGAGGATGCCAGTGCC
CTG
GGATCGTCGTCCTACAAGAAGAAGAAGGAGGCCCAGGACAAAGCCAACAGTGCCAGCTCTCACAACT
GG
AACACACTATTCATGGGGCCGAATGCCGTGGCCGATGCCATCGCACAGAAGTACAACGCCACCAAGAG
T
CAAGTGTTTGACCACGAGACCAAGGGCAGCGTGGCCGTGCGCGTGGCTCTGGGGGAAACCCAGCTCGTC
CAG
GAAGTGCGGCGTTTTCTCATAGACAACGGGGTCAGCCTGGATTCCTTCAGCCAGGCTGCAGCAGAGC
GA
AGCAAGACTGTGATTCTGGTCAAGAACCTCCCGGCAGGCACCCTGGCGGCCCAGCTGCAGGAGACCTT
C
GGCCATTTTGGCAGCCTGGGCCGCGTGCTGCTGCCAGAGGGCGGAATCACTGCCATCGTGGAGTTCCTG
GAG
CCCCTGGAGGCCCGCAAGGCCTTCAGGCATCTGGCCTATTCCAAGTTCCATCATGTCCCCCTCTATC
TG
GAGTGGGCTCCAGTTGGCGTCTTCTCCAGCACAGCCCCACAGAAGAAAAAGCTCCAAGACACACCTTC
A
GAACCCATGGAAAAGGACCCAGCAGAGCCAGAAACAGTGCCTGATGGCGAAACCCCAGAAGATGAAAAT
CCA
ACAGAGGAAGGAGCAGACAACTCTTCAGCAAAGATGGAAGAGGAGGAGGAGGAAGAGGAAGAAGAAG
AA
GAGAGCCTCCCAGGATGTACTCTGTTTATTAAGAATCTCAATTTTGACACAACAGAAGAGAAGCTGAA
G
GAAGTGTTTTCAAAAGTGGGGACAGTGAAGAGCTGCTCCATCTCCAAGAAGAAGAACAAAGCAGGAGTG
CTC
CTTTCCATGGGGTTTGGATTTGTGGAATACAGGAAGCCGGAGCAAGCCCAGAAAGCTCTCAAGCAGC
TC
CAGGGTCACGTCGTGGACGGCCACAAGCTGGAAGTGAGGATCTCGGAACGAGCCACTAAGCCAGCCGT
G
ACATTGGCTCGGAAGAAACAAGTTCCCAGAAAGCAGACCACCTCCAAGATCCTGGTGCGGAACATCCCC
TTC
CAGGCCCACAGCCGGGAGATCCGAGAGCTCTTCAGCACCTTTGGGGAGTTGAAGACGGTCCGCCTGC
CA
AAGAAGATGACTGGGACAGGCACACACAGAGGCTTCGGCTTTGTGGACTTCCTCACCAAGCAGGATGC
G
AAGAGAGCCTTCAACGCCCTGTGTCACAGCACCCACTTGTACGGGCGGAGGCTGGTGCTGGAGTGGGCC
GAC
TCCGAGGTGACCCTGCAGGCCCTGCGGCGGAAGACGGCCGCTCACTTTCACGAGCCCCCGAAGAAAA
AG
CGGTCTGTGGTGTTGGACGAGATCCTGGAGCAGCTGGAAGGCAGTGACAGCGACAGCGAGGAGCAGAC
C
CTTCAGCTGTGA


Translation (960 aa):
MSRLIVKNLPNGMKEERFRQLFAAFGTLTDCSLKFTKDGKFRKFGFIGFKSEEEAQKAQKHFNKSFIDTS
R
IT
VEFCKSFGDPAKPRAWSKHAQKPSQPKQPPKDSTTPEIKKDEKKKKVAGQLEKLKEDTEFQEFLSVH
Q
RRAQAATWANDGLDAEPSKGKSKPASDYLNFDSDSGQESEEEGAGEDLE
EEASLEPKAAVQKELSDMDY
L
KSKMVKAGSSSSSEEEESEDEAVHCDEGSEAEEEDSSATPVLQERDSKGAGQEQGMPAGKKRPPEARAE

T
EKPANQKEPTTCHTVKLRGAPFNVTE
KNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQAL
K
CNREYM
GGRYIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEK
L
FSKY
GPLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQVFQGRMLHVLPSTIKKEASEDASA
L
GSSSYKKKKEAQDKANSA
SSHNWNTLFMGPNAVADAIAQKYNATKSQVFDHETKGSVAVRVALGETQLV
Q
EVRRFLIDNGVSLDSFSQ
AAAERSKTVILVKNLPAGTLAAQLQETFGHFGSLGRVLLPEGGITAIVEFL
E
PLEARKAFRHLAYSK
FHHVPLYLEWAPVGVFSSTAPQKKKLQDTPSEPMEKDPAEPETVPDGETPEDEN
P
TEEGADNSSAKMEEEEEEEEEEEESLPGCTLFIKNLNFDTTEEKLKE
VFSKVGTVKSCSISKKKNKAGV
L
LSMGFGFVEYRKPEQAQKALKQLQ
GHVVDGHKLEVRISERATKPAVTLARKKQVPRKQTTSKILVRNIP
F
QAHSREIRELF
STFGELKTVRLPKKMTGTGTHRGFGFVDFLTKQDAKRAFNALCHSTHLYGRRLVLEWA
D
SEVTLQALRRKTAAHFH
EPPKKKRSVVLDEILEQLEGSDSDSEEQTLQL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser