NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6343.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6343.1 Public Homo sapiens 8 ATAD2 22 109 92 CCDS HistoryNCBI Gene:29028Re-query CCDS DB by CCDS ID:6343.1Re-query CCDS DB by GeneID:29028See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6343.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000287394.9 ENSP00000287394.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000287394.9Link to Ensembl Protein Viewer:ENSP00000287394.5Re-query CCDS DB by Nucleotide ID:ENST00000287394Re-query CCDS DB by Protein ID:ENSP00000287394
Original member NCBI NM_014109.3 NP_054828.2 Updated not alive Link to Nucleotide Sequence:NM_014109.3Link to Protein Sequence:NP_054828.2Re-query CCDS DB by Nucleotide ID:NM_014109Re-query CCDS DB by Protein ID:NP_054828
Current member NCBI NM_014109.4 NP_054828.2 Accepted alive Link to Nucleotide Sequence:NM_014109.4Link to Protein Sequence:NP_054828.2Re-query CCDS DB by Nucleotide ID:NM_014109Re-query CCDS DB by Protein ID:NP_054828Link to BLAST:NP_054828.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_054828.2 1390 Q6PL18-1 1390 100% 0 0

Chromosomal Locations for CCDS 6343.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123321134 123321175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123322938 123323066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123325893 123326026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123328190 123328579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123333878 123334021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123334200 123334322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123336373 123336532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123337625 123337821 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123339311 123339446 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123344884 123345069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123346086 123346272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123346618 123346750 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123347092 123347406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123348183 123348273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123349285 123349444 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123356389 123356477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123357562 123357736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123359221 123359336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123359577 123359685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123361539 123361646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123369058 123369175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123369821 123370024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123370903 123370990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123371236 123371338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123371670 123371835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123372637 123372686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123380529 123380677 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123396187 123396357 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4173 nt):
ATGGTGGTTCTCCGCAGCAGCTTGGAGCTGCACAACCACTCCGCGGCCTCGGCCACGGGCTCCTTGGACC
TG
TCCAGTGACTTCCTCAGTCTGGAGCACATCGGCCGGAGGCGGCTCCGCTCGGCCGGCGCGGCGCAGAA
G
AAACCCGCGGCGACCACAGCCAAAGCGGGCGATGGGTCATCAGTTAAGGAAGTTGAAACCTACCACCGG
ACA
CGTGCTTTAAGATCTTTGAGAAAAGATGCACAGAATTCTTCAGATTCTAGTTTTGAGAAGAATGTGG
AA
ATAACGGAGCAACTTGCTAATGGCAGGCATTTTACAAGGCAGTTGGCCAGACAGCAGGCTGATAAAAA
A
AAAGAAGAGCACAGAGAAGACAAAGTGATTCCAGTTACTCGGTCATTGAGGGCTAGAAACATCGTTCAA
AGT
ACAGAACACTTACATGAAGATAATGGTGATGTTGAAGTGCGTCGAAGTTGTAGGATTAGAAGTCGTT
AT
AGTGGTGTAAACCAGTCCATGCTGTTTGACAAACTTATAACTAACACTGCTGAAGCTGTACTTCAAAA
A
ATGGATGACATGAAGAAGATGCGTAGACAGCGAATGAGAGAACTTGAAGACTTGGGAGTGTTTAATGAA
ACA
GAAGAAAGCAATCTTAATATGTACACAAGAGGAAAACAGAAAGATATTCAAAGAACTGATGAAGAAA
CA
ACTGATAATCAAGAAGGCAGTGTGGAGTCATCTGAAGAGGGTGAAGACCAAGAACATGAAGATGATGG
T
GAAGATGAAGATGATGAAGATGATGATGATGATGACGATGATGATGATGATGATGATGATGAAGATGAT
GAA
GATGAAGAAGATGGAGAAGAAGAGAATCAGAAGCGATATTATCTTAGACAGAGAAAAGCTACTGTTT
AC
TATCAGGCTCCATTGGAAAAACCTCGTCACCAGAGAAAGCCCAACATATTTTATAGTGGCCCAGCTTC
T
CCTGCAAGACCAAGATACCGATTATCTTCCGCAGGACCAAGAAGTCCTTACTGTAAACGAATGAACAGG
CGA
AGGCATGCAATCCACAGTAGTGACTCGACTTCATCTTCCTCCTCTGAAGATGAACAGCACTTTGAGA
GG
CGGAGGAAAAGGAGTCGTAATAGGGCTATCAATAGGTGCCTCCCACTAAATTTTCGGAAAGATGAATT
A
AAAGGCATTTATAAAGATCGAATGAAAATTGGAGCAAGCCTTGCCGATGTTGATCCAATGCAACTAGAT
TCT
TCAGTACGATTTGATAGTGTTGGTGGCCTGTCTAATCATATAGCAGCTCTAAAAGAGATGGTGGTGT
TT
CCATTACTTTATCCAGAAGTCTTTGAAAAATTTAAAATTCAACCCCCAAGAGGTTGTTTGTTTTATGG
G
CCACCTGGAACTGGAAAGACTCTGGTTGCCAGAGCACTTGCCAATGAGTGCAGTCAAGGGGATAAAAGA
GTA
GCATTTTTCATGAGGAAAGGTGCTGATTGTCTAAGTAAATGGGTAGGAGAATCTGAAAGACAGCTAC
GA
TTGCTGTTTGATCAGGCCTATCAGATGCGCCCATCAATTATTTTTTTTGACGAAATTGATGGTCTGGC
T
CCAGTACGGTCAAGCAGGCAAGATCAGATTCACAGTTCTATTGTTTCCACCCTGCTAGCTCTTATGGAT
GGA
TTGGACAGCAGAGGGGAAATTGTGGTCATTGGTGCTACGAACAGGCTAGATTCTATAGATCCTGCTT
TA
CGAAGGCCTGGTCGCTTTGATAGAGAATTCCTCTTTAGCCTGCCTGATAAAGAGGCTCGAAAAGAGAT
T
CTAAAGATTCACACCAGGGATTGGAATCCCAAACCACTGGACACATTTTTAGAAGAGCTAGCAGAAAAC
TGT
GTTGGATACTGTGGAGCAGATATTAAATCAATATGTGCTGAAGCTGCTTTATGTGCTTTACGACGAC
GC
TACCCACAGATCTATACCACTAGTGAGAAACTGCAGTTGGATCTCTCTTCAATTAATATCTCAGCTAA
G
GATTTCGAGGTAGCTATGCAAAAGATGATACCAGCCTCCCAAAGAGCTGTGACATCACCTGGGCAGGCA
CTG
TCCACCGTTGTGAAACCACTCCTGCAAAACACTGTTGACAAGATTTTAGAAGCCCTGCAGAGAGTAT
TT
CCACATGCAGAATTCAGAACAAATAAAACATTAGACTCAGATATTTCTTGTCCTCTGCTAGAAAGTGA
C
TTGGCTTACAGTGATGATGATGTTCCATCAGTTTATGAAAATGGACTTTCTCAGAAATCTTCTCATAAG
GCA
AAAGACAATTTTAATTTTCTTCATTTGAATAGAAATGCTTGTTACCAACCTATGTCTTTTCGACCAA
GA
ATATTGATAGTAGGAGAACCAGGATTTGGGCAAGGTTCTCACTTGGCACCAGCTGTCATTCATGCTTT
G
GAAAAGTTTACTGTATATACATTAGACATTCCTGTTCTTTTTGGAGTTAGTACTACATCCCCTGAAGAA
ACA
TGTGCCCAGGTGATTCGTGAAGCTAAGAGAACAGCACCAAGTATAGTGTATGTTCCTCATATCCACG
TG
TGGTGGGAAATAGTTGGACCGACACTTAAAGCCACATTTACCACATTATTACAGAATATTCCTTCATT
T
GCTCCAGTTTTACTACTTGCAACTTCTGACAAACCCCATTCCGCTTTGCCAGAAGAGGTGCAAGAATTG
TTT
ATCCGTGATTATGGAGAGATTTTTAATGTCCAGTTACCGGATAAAGAAGAACGGACAAAATTTTTTG
AA
GATTTAATTCTAAAACAAGCTGCTAAGCCTCCTATATCAAAAAAGAAAGCAGTTTTGCAGGCTTTGGA
G
GTACTCCCAGTAGCACCACCACCTGAGCCAAGATCACTGACAGCAGAAGAAGTGAAACGACTAGAAGAA
CAA
GAAGAAGATACATTTAGAGAACTGAGGATTTTCTTAAGAAATGTTACACATAGGCTTGCTATTGACA
AG
CGATTCCGAGTGTTTACTAAGCCTGTTGACCCTGATGAGGTTCCTGATTATGTCACTGTAATAAAGCA
A
CCAATGGACCTTTCATCTGTAATCAGTAAAATTGATCTACACAAGTATCTGACTGTGAAAGACTATTTG
AGA
GATATTGATCTAATCTGTAGTAATGCCTTAGAATACAATCCAGATAGAGATCCTGGAGATCGTCTTA
TT
AGGCATAGAGCCTGTGCTTTAAGAGATACTGCCTATGCCATAATTAAAGAAGAACTTGATGAAGACTT
T
GAGCAGCTCTGTGAAGAAATTCAGGAATCTAGAAAGAAAAGAGGTTGTAGCTCCTCCAAATATGCCCCG
TCT
TACTACCATGTGATGCCAAAGCAAAATTCCACTCTTGTTGGTGATAAAAGATCAGACCCAGAGCAGA
AT
GAAAAGCTAAAGACACCGAGTACTCCTGTGGCTTGCAGCACTCCTGCTCAGTTGAAGAGGAAAATTCG
C
AAAAAGTCAAACTGGTACTTAGGCACCATAAAAAAGCGAAGGAAGATTTCACAGGCAAAGGATGATAGC
CAG
AATGCCATAGATCACAAAATTGAGAGTGATACAGAGGAAACTCAAGACACAAGTGTAGATCATAATG
AG
ACCGGAAACACAGGAGAGTCTTCGGTGGAAGAAAATGAAAAACAGCAAAATGCCTCTGAAAGCAAACT
G
GAATTGAGAAATAATTCAAATACTTGTAATATAGAGAATGAGCTTGAAGACTCTAGGAAGACTACAGCA
TGT
ACAGAATTGAGAGACAAGATTGCTTGTAATGGAGATGCTTCTAGCTCTCAGATAATACATATTTCTG
AT
GAAAATGAAGGAAAAGAAATGTGTGTTCTGCGAATGACTCGAGCTAGACGTTCCCAGGTAGAACAGCA
G
CAGCTCATCACTGTTGAAAAGGCTTTGGCAATTCTTTCTCAGCCTACACCCTCACTTGTTGTGGATCAT
GAG
CGATTAAAAAATCTTTTGAAGACTGTTGTTAAAAAAAGTCAAAACTACAACATATTTCAGTTGGAAA
AT
TTGTATGCAGTAATCAGCCAATGTATTTATCGGCATCGCAAGGACCATGATAAAACATCACTTATTCA
G
AAAATGGAGCAAGAGGTAGAAAACTTCAGTTGTTCCAGATGA


Translation (1390 aa):
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGSSVKEVETYHR
T
RALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFT
RQLARQQADKKKEEHREDKVIPVTRSLRARNIVQ
S
TEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLIT
NTAEAVLQKMDDMKKMRRQRMRELEDLGVFNE
T
EE
SNLNMYTRGKQKDIQRTDEETTDNQEGSVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDD
E
DEEDGEEENQKRYYLRQRKATVYYQAPLE
KPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNR
R
RHAIHSSDSTSSSSSEDEQHFERRRKRSRNRAIN
RCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
S
S
VRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARALANECSQGDKR
V
AFFMRKGADCLSKWVGESERQLRLLFDQ
AYQMRPSIIFFDEIDGLAPVRSSRQDQIHSSIVSTLLALMD
G
LDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPDKE
ARKEILKIHTRDWNPKPLDTFLEELAEN
C
V
GYCGADIKSICAEAALCALRRRYPQIYTTSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQA
L
STVVKPLLQNTVDKILEALQRVFPHAEFRTNKTLDS
DISCPLLESDLAYSDDDVPSVYENGLSQKSSHK
A
KDNFNFLHLN
RNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
T
CAQ
VIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPHSALPEEVQEL
F
IRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKA
VLQALEVLPVAPPPEPRSLTAEEVKRLEE
Q
EEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDE
VPDYVTVIKQPMDLSSVISKIDLHKYLTVKDYL
R
DIDLICSNALEYNPDRDPG
DRLIRHRACALRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAP
S
YYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTP
AQLKRKIRKKSNWYLGTIKKRRKISQAKDDS
Q
NAIDHKIESDTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
C
TELRDKIACNGDASSSQIIHISDENEGK
EMCVLRMTRARRSQVEQQQLITVEKALAILSQPTPSLVVDH
E
RLK
NLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKMEQEVENFSCSR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser