NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43139.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43139.1 Public Homo sapiens 3 FAM162A 22 109 92 CCDS HistoryNCBI Gene:26355Re-query CCDS DB by CCDS ID:43139.1Re-query CCDS DB by GeneID:26355See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43139.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000477892.5 ENSP00000419088.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000477892.5Link to Ensembl Protein Viewer:ENSP00000419088.1Re-query CCDS DB by Nucleotide ID:ENST00000477892Re-query CCDS DB by Protein ID:ENSP00000419088
Original member NCBI NM_014367.3 NP_055182.3 Updated not alive Link to Nucleotide Sequence:NM_014367.3Link to Protein Sequence:NP_055182.3Re-query CCDS DB by Nucleotide ID:NM_014367Re-query CCDS DB by Protein ID:NP_055182
Current member NCBI NM_014367.4 NP_055182.3 Accepted alive Link to Nucleotide Sequence:NM_014367.4Link to Protein Sequence:NP_055182.3Re-query CCDS DB by Nucleotide ID:NM_014367Re-query CCDS DB by Protein ID:NP_055182Link to BLAST:NP_055182.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_055182.3 154 Q96A26 154 100% 0 0

Chromosomal Locations for CCDS 43139.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 122384266 122384299 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122402760 122402882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122404258 122404363 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122407281 122407389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 122409739 122409831 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (465 nt):
ATGGGGAGCCTCAGCGGTCTGCGCCTGGCAGCAGGAAGCTGTTTTAGGTTATGTGAAAGAGATGTTTCCT
CA
TCTCTAAGGCTTACCAGAAGCTCTGATTTGAAGAGAATAAATGGATTTTGCACAAAACCACAGGAAAG
T
CCCGGAGCTCCATCCCGCACTTACAACAGAGTGCCTTTACACAAACCTACGGATTGGCAGAAAAAGATC
CTC
ATATGGTCAGGTCGCTTCAAAAAGGAAGATGAAATCCCAGAGACTGTCTCGTTGGAGATGCTTGATG
CT
GCAAAGAACAAGATGCGAGTGAAGATCAGCTATCTAATGATTGCCCTGACGGTGGTAGGATGCATCTT
C
ATGGTTATTGAGGGCAAGAAGGCTGCCCAAAGACACGAGACTTTAACAAGCTTGAACTTAGAAAAGAAA
GCT
CGTCTGAAAGAGGAAGCAGCTATGAAGGCCAAAACAGAGTAG


Translation (154 aa):
MGSLSGLRLAAGSCFRLCERDVSSSLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKI
L
IWSGRFKKEDEIPETV
SLEMLDAAKNKMRVKISYLMIALTVVGCIFMVIEGKKAAQRHETLTSLNLEKK
A
RLKEEAAMKAKTE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser