NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45234.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45234.1 Public Homo sapiens 15 NUSAP1 22 109 92 CCDS HistoryNCBI Gene:51203Re-query CCDS DB by CCDS ID:45234.1Re-query CCDS DB by GeneID:51203See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45234.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000559596.5 ENSP00000453403.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000559596.5Link to Ensembl Protein Viewer:ENSP00000453403.1Re-query CCDS DB by Nucleotide ID:ENST00000559596Re-query CCDS DB by Protein ID:ENSP00000453403
Original member NCBI NM_016359.4 NP_057443.2 Updated not alive Link to Nucleotide Sequence:NM_016359.4Link to Protein Sequence:NP_057443.2Re-query CCDS DB by Nucleotide ID:NM_016359Re-query CCDS DB by Protein ID:NP_057443
Current member NCBI NM_016359.5 NP_057443.2 Accepted alive Link to Nucleotide Sequence:NM_016359.5Link to Protein Sequence:NP_057443.2Re-query CCDS DB by Nucleotide ID:NM_016359Re-query CCDS DB by Protein ID:NP_057443Link to BLAST:NP_057443.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057443.2 441 Q9BXS6-1 441 100% 0 0

Chromosomal Locations for CCDS 45234.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 41332958 41333050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41342386 41342454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41349098 41349241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41350988 41351129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41356039 41356140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41358149 41358258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41365402 41365589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41371527 41371684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41375712 41375828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41377196 41377304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 41380093 41380186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1326 nt):
ATGATCATCCCCTCTCTAGAGGAGCTGGACTCCCTCAAGTACAGTGACCTGCAGAACTTAGCCAAGAGTC
TG
GGTCTCCGGGCCAACCTGAGGGCAACCAAGTTGTTAAAAGCCTTGAAAGGCTACATTAAACATGAGGC
A
AGAAAAGGAAATGAGAATCAGGATGAAAGTCAAACTTCTGCATCCTCTTGTGATGAGACTGAGATACAG
ATC
AGCAACCAGGAAGAAGCTGAGAGACAGCCACTTGGCCATGTCACCAAAACAAGGAGAAGGTGCAAGA
CT
GTCCGTGTGGACCCTGACTCACAGCAGAATCATTCAGAGATAAAAATAAGTAATCCCACTGAATTCCA
G
AATCATGAAAAGCAGGAAAGCCAGGATCTCAGAGCTACTGCAAAAGTTCCTTCTCCACCAGACGAGCAC
CAA
GAAGCTGAGAATGCTGTTTCCTCAGGTAACAGAGATTCAAAGGTACCTTCAGAAGGAAAGAAATCTC
TC
TACACAGATGAGTCATCCAAACCTGGAAAAAATAAAAGAACTGCAATCACTACTCCAAACTTTAAGAA
G
CTTCATGAAGCTCATTTTAAGGAAATGGAGTCCATTGATCAATATATTGAGAGAAAAAAGAAACATTTT
GAA
GAACACAATTCCATGAATGAACTGAAGCAGCAGCCCATCAATAAGGGAGGGGTCAGGACTCCAGTAC
CT
CCAAGAGGAAGACTCTCTGTGGCTTCTACTCCCATCAGCCAACGACGCTCGCAAGGCCGGTCTTGTGG
C
CCTGCAAGTCAGAGTACCTTGGGTCTGAAGGGGTCACTCAAGCGCTCTGCTATCTCTGCAGCTAAAACG
GGT
GTCAGGTTTTCAGCTGCTACTAAAGATAATGAGCATAAGCGTTCACTGACCAAGACTCCAGCCAGAA
AG
TCTGCACATGTGACCGTGTCTGGGGGCACCCCAAAAGGCGAGGCTGTGCTTGGGACACACAAATTAAA
G
ACCATCACGGGGAATTCTGCTGCTGTTATTACCCCATTCAAGTTGACAACTGAGGCAACGCAGACTCCA
GTC
TCCAATAAGAAACCAGTGTTTGATCTTAAAGCAAGTTTGTCTCGTCCCCTCAACTATGAACCACACA
AA
GGAAAGCTAAAACCATGGGGGCAATCTAAAGAAAATAATTATCTAAATCAACATGTCAACAGAATTAA
C
TTCTACAAGAAAACTTACAAACAACCCCATCTCCAGACAAAGGAAGAGCAACGGAAGAAACGCGAGCAA
GAA
CGAAAGGAGAAGAAAGCAAAGGTTTTGGGAATGCGAAGGGGCCTCATTTTGGCTGAAGATTAA


Translation (441 aa):
MIIPSLEELDSLKYSDLQNLAKSLGLRANLRATKLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQ
I
SNQEEAERQPLGHVTKTRRRCKTVRVDPDSQ
QNHSEIKISNPTEFQNHEKQESQDLRATAKVPSPPDEH
Q
EAENAVSS
GNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAHFKEMESIDQYIERKKKHF
E
EHNSMNELK
QQPINKGGVRTPVPPRGRLSVASTPISQRRSQGRSCGPASQSTLGLKGSLKRSAISAAKT
G
V
RFSAATKDNEHKRSLTKTPARKSAHVTVSGGTPKGEAVLGTHKLKTITGNSAAVITPFKLTTEATQTP
V
SNKKPVFDLKASLSRPLNYEPHK
GKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQTKEEQRKKREQ
E
RKEKKAKVLGMRRGLILAED




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser