NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, January 26, 2022, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34001.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34001.1 Public Homo sapiens 4 RUFY3 22 109 92 CCDS HistoryNCBI Gene:22902Re-query CCDS DB by CCDS ID:34001.1Re-query CCDS DB by GeneID:22902See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34001.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381006.7 ENSP00000370394.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381006.7Link to Ensembl Protein Viewer:ENSP00000370394.3Re-query CCDS DB by Nucleotide ID:ENST00000381006Re-query CCDS DB by Protein ID:ENSP00000370394
Original member NCBI NM_001037442.3 NP_001032519.1 Updated not alive Link to Nucleotide Sequence:NM_001037442.3Link to Protein Sequence:NP_001032519.1Re-query CCDS DB by Nucleotide ID:NM_001037442Re-query CCDS DB by Protein ID:NP_001032519
Current member NCBI NM_001037442.4 NP_001032519.1 Accepted alive Link to Nucleotide Sequence:NM_001037442.4Link to Protein Sequence:NP_001032519.1Re-query CCDS DB by Nucleotide ID:NM_001037442Re-query CCDS DB by Protein ID:NP_001032519Link to BLAST:NP_001032519.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001032519.1 620 Q7L099-3 620 100% 0 0

Chromosomal Locations for CCDS 34001.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 70722574 70722751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70762519 70762692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70763552 70763669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70764475 70764576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70768538 70768661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70773511 70773572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70775168 70775233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70778369 70778438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70783091 70783183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70784796 70784879 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70788806 70788973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70789495 70789592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70793785 70793904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70794795 70794894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70800141 70800205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70802956 70802983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70804348 70804416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 70806516 70806659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1863 nt):
ATGTCTGCTCTGACGCCTCCGACCGATATGCCAACCCCCACCACTGACAAGATCACACAGGCTGCCATGG
AG
ACCATCTACCTTTGCAAATTCCGAGTGTCCATGGATGGAGAATGGCTCTGCCTGCGAGAGCTGGATGA
C
ATCTCACTTACACCTGACCCAGAGCCTACCCATGAAGATCCTAATTATCTCATGGCTAATGAACGCATG
AAC
CTCATGAACATGGCCAAGCTGAGTATCAAGGGCTTGATTGAATCAGCTCTGAACCTGGGGAGGACTC
TT
GACTCTGACTATGCACCTCTCCAGCAATTCTTTGTGGTGATGGAGCACTGTCTGAAACATGGCTTGAA
A
GCTAAAAAAACTTTTCTCGGACAAAATAAATCCTTCTGGGGGCCTCTAGAACTGGTAGAAAAGCTTGTT
CCA
GAAGCCGCAGAGATAACAGCAAGTGTTAAAGATCTTCCAGGACTTAAGACACCAGTAGGTAGAGGAA
GA
GCCTGGCTTCGTTTGGCATTAATGCAAAAGAAACTTTCAGAATATATGAAAGCTTTGATCAATAAGAA
A
GAACTTCTCAGTGAATTCTACGAACCCAATGCCCTCATGATGGAAGAAGAAGGAGCCATAATTGCTGGT
CTG
TTGGTGGGTCTGAATGTCATTGATGCCAATTTCTGTATGAAAGGAGAAGACTTGGACTCTCAGGTTG
GA
GTTATAGATTTTTCAATGTATCTCAAGGACGGGAACAGCAGTAAAGGTACTGAAGGAGACGGTCAGAT
T
ACTGCAATTCTGGACCAGAAGAACTATGTAGAAGAACTGAACAGACATTTGAATGCTACTGTAAACAAC
CTT
CAGGCAAAAGTAGATGCATTAGAAAAATCCAACACTAAACTGACAGAGGAGCTTGCAGTTGCAAACA
AC
AGGATCATTACCTTACAAGAAGAAATGGAACGAGTTAAAGAGGAAAGTTCCTACATACTGGAATCCAA
T
CGGAAGGGTCCCAAGCAAGACAGAACTGCAGAAGGGCAAGCACTAAGTGAAGCAAGAAAGCATTTAAAA
GAA
GAGACACAATTACGATTGGATGTTGAGAAAGAACTGGAGATGCAGATCAGCATGAGGCAGGAGATGG
AA
TTGGCTATGAAGATGCTGGAGAAGGATGTCTGTGAGAAGCAGGATGCCCTGGTATCTCTTCGGCAGCA
G
CTGGATGACCTCAGAGCTCTCAAGCATGAACTTGCCTTTAAGCTGCAGAGTTCAGACTTAGGAGTAAAA
CAG
AAAAGTGAACTAAACAGTCGCTTGGAAGAGAAGACTAATCAGATGGCTGCTACCATTAAACAACTTG
AA
CAAAGATTGCGCCAGGCTGAGCGAAGCCGCCAATCTGCTGAGTTGGACAACCGGCTCTTCAAACAGGA
C
TTTGGAGACAAGATCAACAGTCTGCAGCTGGAAGTCGAGGAGCTCACCAGGCAGCGGAACCAGCTTGAG
TTA
GAACTAAAACAGGAAAAAGAAAGAAGATTACAAAACGACAGGAGCATCCCAGGAAGGGGTTCCCAGA
AG
TCAGAATCCAAGATGGATGGGAAGCACAAAATGCAAGAGGAAAATGTTAAACTAAAAAAGCCCCTGGA
A
GAAAGCCACAGGCTGCAACCCCACCCTATGGATGAACAGGATCAGCTGCTGCTCTCTGAAAAGCCACAG
TTG
TGTCAGCTATGCCAGGAAGACGGCAGCCTAACAAAGAATGTGTGTAAGAACTGCAGCGGAACCTTCT
GT
GATGCCTGTTCAACAAATGAACTGCCTCTTCCTTCAAGTATCAAGCTTGAGCGAGTTTGCAATCCCTG
T
CACAAGCATCTGATGAAGCAATATTCTACCAGCCCATCATAA


Translation (620 aa):
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERM
N
LMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLK
AKKTFLGQNKSFWGPLELVEKLV
P
EAAEITASVKDLPGL
KTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAG
L
LVGLNVIDANFCMKGEDLDSQ
VGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNN
L
QAKVDALEKSNTKLTEE
LAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLK
E
ETQLRL
DVEKELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVK
Q
KSELNSRLEEKTNQMAATIKQLEQ
RLRQAERSRQSAELDNRLFKQDFGDKINSLQLEVEELTRQRNQLE
L
ELKQEKERRLQNDRSIPGRGSQKSESKM
DGKHKMQEENVKLKKPLEESHRLQPHPMDEQDQLLLSEKPQ
L
CQLCQEDGSLTK
NVCKNCSGTFCDACSTNELPLPSSIKLERVCNPCHKHLMKQYSTSPS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser