NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15442.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15442.1 Public Mus musculus 1 Mpc2 23 108 98 CCDS HistoryNCBI Gene:70456Re-query CCDS DB by CCDS ID:15442.1Re-query CCDS DB by GeneID:70456See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15442.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000027853.5 ENSMUSP00000027853.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027853.5Link to Ensembl Protein Viewer:ENSMUSP00000027853.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000027853Re-query CCDS DB by Protein ID:ENSMUSP00000027853
Original member Current member NCBI NM_027430.3 NP_081706.1 Accepted alive Link to Nucleotide Sequence:NM_027430.3Link to Protein Sequence:NP_081706.1Re-query CCDS DB by Nucleotide ID:NM_027430Re-query CCDS DB by Protein ID:NP_081706Link to BLAST:NP_081706.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081706.1 127 Q9D023 127 100% 0 0

Chromosomal Locations for CCDS 15442.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 165461403 165461511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165474954 165474994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165478221 165478305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165479467 165479578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 165480903 165480939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (384 nt):
ATGGCAGCTGCCGGCGCCCGAGGCCTGCGGGCCACCTACCACCGACTCATGGATAAAGTGGAGTTGTTGC
TG
CCAAAGAAATTGAGGCCGCTTTACAACCACCCGGCAGGCCCCAGAACAGTTTTTTTCTGGGCTCCAAT
A
ATGAAATGGGGATTGGTGTGTGCTGGACTAGCGGACATGGCCAGACCTGCAGAGAAACTCAGCACAGCT
CAG
TCCACTGTGTTGATGGCTACAGGGTTTATTTGGTCAAGATATTCACTTGTAATTATACCAAAAAATT
GG
AGTTTGTTCGCTGTTAATTTCTTTGTGGGGTCAGCAGGAGCCTCTCAGCTGTTTCGGATTTGGAGATA
T
AACCAAGAACTCAAATCTAAAGGGATCCAGTAA


Translation (127 aa):
MAAAGARGLRATYHRLMDKVELLLPKKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADMARPAEKLSTA
Q
STVLMAT
GFIWSRYSLVIIPKNWSLFAVNFFVGSAGASQLFRIWRYNQELKSKGIQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser