NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS27873.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27873.1 Public Mus musculus 15 Csad 23 108 98 CCDS HistoryNCBI Gene:246277Re-query CCDS DB by CCDS ID:27873.1Re-query CCDS DB by GeneID:246277See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27873.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000023805.2 ENSMUSP00000023805.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000023805.2Link to Ensembl Protein Viewer:ENSMUSP00000023805.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000023805Re-query CCDS DB by Protein ID:ENSMUSP00000023805
Original member Current member NCBI NM_001359126.1 NP_001346055.1 Accepted alive Link to Nucleotide Sequence:NM_001359126.1Link to Protein Sequence:NP_001346055.1Re-query CCDS DB by Nucleotide ID:NM_001359126Re-query CCDS DB by Protein ID:NP_001346055Link to BLAST:NP_001346055.1
Original member Current member NCBI NM_144942.4 NP_659191.1 Accepted alive Link to Nucleotide Sequence:NM_144942.4Link to Protein Sequence:NP_659191.1Re-query CCDS DB by Nucleotide ID:NM_144942Re-query CCDS DB by Protein ID:NP_659191Link to BLAST:NP_659191.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001346055.1 493 Q9DBE0 493 100% 0 0
NP_659191.1 493 Q9DBE0 493 100% 0 0

Chromosomal Locations for CCDS 27873.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 102177613 102177786 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102178527 102178616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102178781 102178832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102178961 102179160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102179521 102179602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102179829 102179893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102179971 102180087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102185998 102186052 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102186394 102186473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102187054 102187169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102187566 102187672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102188007 102188097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102188182 102188308 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 102188543 102188668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1482 nt):
ATGGCTGACTCAAAACCACTCAGGACCCTGGATGGGGACCCCGTGGCTGTGGAGGCCTTGCTCCAGGACG
TG
TTTGGGATTGTTGTAGATGAGGCCATTCTGAAGGGGACCAGTGCCTCTGAGAAGGTCTGCGAATGGAA
G
GAGCCTGAAGAACTCAAGCAGCTGCTGGACTTGGAGCTGCAGAGCCAGGGCGAGTCCCGGGAGCAGATC
CTG
GAGCGCTGCCGGACTGTGATTCACTACAGTGTCAAGACTGGTCACCCCCGGTTCTTCAACCAGCTCT
TC
TCAGGGTTAGATCCCCATGCTCTGGCTGGGCGCATCATCACGGAGAGCCTCAACACTAGCCAGTACAC
A
TATGAGATTGCCCCCGTGTTTGTGCTCATGGAAGAGGAGGTGCTGAAGAAACTCCGTGCCCTGGTGGGC
TGG
AACTCTGGGGATGGGGTCTTCTGTCCTGGTGGCTCCATCTCCAACATGTACGCCATGAACCTGGCCC
GC
TTTCAGCGCTACCCAGACTGCAAGCAGAGGGGCCTCCGGGCCCTGCCGCCCTTGGCTCTCTTCACTTC
A
AAGGAGTGTCACTACTCCATCACCAAGGGAGCTGCTTTTCTGGGACTTGGCACCGACAGTGTCCGAGTG
GTC
AAGGCTGATGAGAGAGGGAGGATGATCCCTGAGGACCTGGAGAGGCAGATCATTCTGGCAGAGGCTG
AG
GGCTCTGTGCCATTTCTGGTCAGTGCCACCTCTGGTACCACCGTGCTAGGGGCCTTTGACCCCCTGGA
T
GCAATTGCCGATGTTTGCCAGCGACACGGACTGTGGTTCCATGTGGATGCTGCCTGGGGTGGGAGCGTC
CTG
CTGTCTCGGACACACAGGCATCTCCTGGATGGGATCCAGAGGGCTGACTCTGTGGCCTGGAACCCTC
AC
AAGCTTCTCGCCGCAGGGCTGCAGTGCTCCGCTCTTCTTCTCCGGGACACCTCGAACCTGCTCAAGCG
C
TGCCATGGATCCCAGGCCAGCTACCTCTTCCAGCAAGACAAGTTCTACGATGTGGCTCTGGACACCGGA
GAC
AAAGTGGTGCAGTGTGGCCGCCGCGTGGACTGTCTGAAGCTATGGCTCATGTGGAAGGCACAGGGTG
GG
CAGGGGTTGGAGCGGCGCATCGACCAGGCCTTTGCTCTCACCCGGTACTTGGTGGAGGAGATTAAAAA
G
CGGGAAGGATTTGAGTTGGTAATGGAGCCCGAGTTCGTCAACGTGTGCTTCTGGTTTGTGCCTCCCAGC
CTT
CGGGGGAAGAAGGAGAGTCCAGATTACAGCCAAAGGCTGTCTCAGGTGGCCCCTGTGCTCAAGGAGC
GC
ATGGTGAAGAAGGGGACCATGATGATTGGCTACCAGCCCCATGGGACCCGGGCCAACTTCTTCCGAAT
G
GTGGTGGCCAACCCCATACTGGCCCAGGCCGATATAGATTTCCTTCTGGGCGAGCTGGAGCTCCTGGGC
CAG
GACCTGTGA


Translation (493 aa):
MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQI
L
ERCRTVIHYSVKT
GHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVG
W
NSGDGVFCP
GGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRV
V
KADE
RGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSV
L
LSRTHRHLLDGIQ
RADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTG
D
KVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALT
RYLVEEIKKREGFELVMEPEFVNVCFWFVPPS
L
RGKKESPDYSQRLSQ
VAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLG
Q
DL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser