NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq

Report for CCDS37756.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37756.1 Public Mus musculus 18 Nrep 23 108 98 CCDS HistoryNCBI Gene:27528Re-query CCDS DB by CCDS ID:37756.1Re-query CCDS DB by GeneID:27528See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 37756.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000051087.15 ENSMUSP00000058132.8 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051087.15Link to Ensembl Protein Viewer:ENSMUSP00000058132.8Re-query CCDS DB by Nucleotide ID:ENSMUST00000051087Re-query CCDS DB by Protein ID:ENSMUSP00000058132
Original member Current member EBI ENSMUST00000171533.8 ENSMUSP00000127787.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171533.8Link to Ensembl Protein Viewer:ENSMUSP00000127787.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000171533Re-query CCDS DB by Protein ID:ENSMUSP00000127787
Original member Current member EBI ENSMUST00000168890.1 ENSMUSP00000130297.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000168890.1Link to Ensembl Protein Viewer:ENSMUSP00000130297.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000168890Re-query CCDS DB by Protein ID:ENSMUSP00000130297
Original member Current member EBI ENSMUST00000237066.1 ENSMUSP00000157912.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000237066.1Link to Ensembl Protein Viewer:ENSMUSP00000157912.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000237066Re-query CCDS DB by Protein ID:ENSMUSP00000157912
Original member Current member NCBI NM_001109988.1 NP_001103458.1 Accepted alive Link to Nucleotide Sequence:NM_001109988.1Link to Protein Sequence:NP_001103458.1Re-query CCDS DB by Nucleotide ID:NM_001109988Re-query CCDS DB by Protein ID:NP_001103458Link to BLAST:NP_001103458.1
Original member Current member NCBI NM_001109989.2 NP_001103459.1 Accepted alive Link to Nucleotide Sequence:NM_001109989.2Link to Protein Sequence:NP_001103459.1Re-query CCDS DB by Nucleotide ID:NM_001109989Re-query CCDS DB by Protein ID:NP_001103459Link to BLAST:NP_001103459.1
Original member Current member NCBI NM_001267717.1 NP_001254646.1 Accepted alive Link to Nucleotide Sequence:NM_001267717.1Link to Protein Sequence:NP_001254646.1Re-query CCDS DB by Nucleotide ID:NM_001267717Re-query CCDS DB by Protein ID:NP_001254646Link to BLAST:NP_001254646.1
Original member Current member NCBI NM_053078.4 NP_444308.1 Accepted alive Link to Nucleotide Sequence:NM_053078.4Link to Protein Sequence:NP_444308.1Re-query CCDS DB by Nucleotide ID:NM_053078Re-query CCDS DB by Protein ID:NP_444308Link to BLAST:NP_444308.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001103458.1 68 Q07475 68 100% 0 0
NP_001103459.1 68 Q07475 68 100% 0 0
NP_001254646.1 68 Q07475 68 100% 0 0
NP_444308.1 68 Q07475 68 100% 0 0

Chromosomal Locations for CCDS 37756.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 33438714 33438839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 33442816 33442893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 33462021 33462023 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGGTTTACTACCCAGAACTCTTGGTCTGGGTCAGCCAAGAACCGTTTGCATACAAGGAAATGGAGGGAG
GTCTTATTAAGGGAAGACTTCCCGTGCCTAAGGAAGTGAACCGAAAGAAGATGGAGGAGACTGGCGCTGC
CTCGCTGACTCCGCCAGGCAGCCGTGAATTCACCTCTCCAGCTACCAGTTACCTCCACCCTTTTTAA

Translation (68 aa):
MVYYPELLVWVSQEPFAYKEMEGGLIKGRLPVPKEVNRKKMEETGAASLTPPGSREFTSPATSYLHPF


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH