NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS15271.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
15271.1 Public Mus musculus 1 Ctse 23 108 98 CCDS HistoryNCBI Gene:13034Re-query CCDS DB by CCDS ID:15271.1Re-query CCDS DB by GeneID:13034See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 15271.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000073350.12 ENSMUSP00000073072.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000073350.12Link to Ensembl Protein Viewer:ENSMUSP00000073072.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000073350Re-query CCDS DB by Protein ID:ENSMUSP00000073072
Original member Current member NCBI NM_007799.3 NP_031825.2 Accepted alive Link to Nucleotide Sequence:NM_007799.3Link to Protein Sequence:NP_031825.2Re-query CCDS DB by Nucleotide ID:NM_007799Re-query CCDS DB by Protein ID:NP_031825Link to BLAST:NP_031825.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031825.2 397 P70269 397 100% 0 0

Chromosomal Locations for CCDS 15271.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 131661996 131662066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131662613 131662769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131663311 131663428 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131664284 131664402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131668037 131668236 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131670686 131670808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131672204 131672345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131672445 131672543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 131674781 131674945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1194 nt):
ATGAAGCCCCTCCTTGTGCTGCTGCTGCTGCTGCTCCTGGATCTGGCTCAGGCCCAAGGTGCTCTGCACA
G
A
GTGCCCCTCAGAAGACATCAGTCCCTTCGGAAGAAACTACGGGCCCAAGGACAGCTCTCAGAATTCTG
G
AGGTCTCATAACTTGGACATGACCCGACTCAGCGAGTCCTGTAATGTGTATTCGAGTGTCAATGAACCC
CTC
ATCAACTACCTGGATATGGAATACTTTGGCACCATCTCCATCGGCACCCCGCCGCAGAACTTCACTG
TC
ATCTTTGACACCGGTTCATCCAACCTCTGGGTCCCTTCTGTGTACTGCACCAGCCCAGCATGCAAGGC
A
CACCCAGTATTCCATCCATCGCAGTCCGACACATACACGGAGGTAGGGAATCATTTCTCCATCCAGTAT
GGT
ACCGGGAGCCTGACAGGAATCATTGGAGCTGATCAAGTCTCTGTGGAAGGGTTGACTGTGGATGGCC
AG
CAGTTTGGAGAAAGTGTCAAGGAGCCAGGCCAGACCTTTGTGAATGCAGAGTTTGATGGGATTCTGGG
T
CTGGGATACCCCTCATTGGCTGCTGGAGGAGTGACCCCAGTGTTTGACAACATGATGGCCCAGAACCTT
GTG
GCTCTGCCTATGTTTTCTGTCTACTTGAGCAGTGACCCTCAAGGTGGCTCAGGCAGTGAGCTGACTT
TC
GGAGGCTATGACCCCTCTCATTTCTCTGGGAGCCTCAACTGGATCCCAGTCACCAAGCAAGCCTATTG
G
CAGATTGCCCTGGATGGAATCCAGGTGGGAGACACTGTGATGTTCTGCTCCGAAGGCTGCCAGGCCATA
GTG
GACACAGGGACCTCTCTCATCACTGGCCCCCCCGACAAGATCAAACAGCTTCAAGAGGCCATTGGGG
CC
ACACCCATTGATGGAGAATATGCAGTGGATTGTGCCACTCTCGACACGATGCCAAACGTTACCTTCCT
C
ATCAACGAGGTTTCATATACCCTCAACCCAACTGACTACATCCTGCCGGACTTGGTGGAAGGAATGCAG
TTC
TGTGGCAGTGGCTTTCAAGGACTTGACATTCCACCTCCAGCTGGGCCCCTCTGGATCCTGGGGGATG
TC
TTCATCCGACAGTTCTACTCAGTCTTTGACCGTGGAAATAACCAAGTGGGATTGGCCCCCGCAGTTCC
C
TAA


Translation (397 aa):
MKPLLVLLLLLLLDLAQAQGALHRVPLRRHQSLRKKLRAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEP
L
INYLD
MEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQY
G
TGSLTGIIGADQVS
VEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNL
V
ALPMFSVYLS
SDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAI
V
DTGTSLITGPPDKIKQLQEAIGATPIDGE
YAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQ
F
CGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser