NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS34939.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
34939.1 Public Homo sapiens 8 ANXA13 22 109 92 CCDS HistoryNCBI Gene:312Re-query CCDS DB by CCDS ID:34939.1Re-query CCDS DB by GeneID:312See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 34939.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000262219.10 ENSP00000262219.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000262219.10Link to Ensembl Protein Viewer:ENSP00000262219.6Re-query CCDS DB by Nucleotide ID:ENST00000262219Re-query CCDS DB by Protein ID:ENSP00000262219
Original member NCBI NM_001003954.2 NP_001003954.1 Updated not alive Link to Nucleotide Sequence:NM_001003954.2Link to Protein Sequence:NP_001003954.1Re-query CCDS DB by Nucleotide ID:NM_001003954Re-query CCDS DB by Protein ID:NP_001003954
Current member NCBI NM_001003954.3 NP_001003954.1 Accepted alive Link to Nucleotide Sequence:NM_001003954.3Link to Protein Sequence:NP_001003954.1Re-query CCDS DB by Nucleotide ID:NM_001003954Re-query CCDS DB by Protein ID:NP_001003954Link to BLAST:NP_001003954.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001003954.1 357 P27216-2 357 100% 0 0

Chromosomal Locations for CCDS 34939.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123681240 123681359 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123684610 123684722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123688871 123688946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123693197 123693298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123693711 123693779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123695502 123695581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123695688 123695721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123698389 123698559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123702642 123702736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123712678 123712753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123735755 123735877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123737320 123737334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1074 nt):
ATGGGCAATCGTCATAGCCAGTCGTACACCCTCTCAGAAGGCAGTCAACAGTTGCCTAAAGGGGACTCCC
AA
CCCTCGACAGTCGTGCAGCCTCTCAGCCACCCATCACGGAATGGAGAGCCAGAGGCCCCACAGCCTGC
T
AAAGCGAGCAGTCCTCAGGGTTTTGATGTGGATCGAGATGCCAAAAAGCTGAACAAAGCCTGCAAAGGA
ATG
GGGACCAATGAAGCAGCCATCATTGAAATCTTATCGGGCAGGACATCAGATGAGAGGCAACAAATCA
AG
CAAAAGTACAAGGCAACGTACGGCAAGGAGCTGGAGGAAGTACTCAAGAGTGAGCTGAGTGGAAACTT
C
GAGAAGACAGCGTTGGCCCTTCTGGACCGTCCCAGCGAGTACGCCGCCCGGCAGCTGCAGAAGGCTATG
AAG
GGTCTGGGCACAGATGAGTCCGTCCTCATTGAGGTCCTGTGCACGAGGACCAATAAGGAAATCATCG
CC
ATTAAAGAGGCCTACCAAAGGCTATTTGATAGGAGCCTCGAATCAGATGTCAAAGGTGATACAAGTGG
A
AACCTAAAAAAAATCCTGGTGTCTCTGCTGCAGGCTAATCGCAATGAAGGAGATGACGTGGACAAAGAT
CTA
GCTGGTCAGGATGCCAAAGATCTGTATGATGCAGGGGAAGGCCGCTGGGGCACTGATGAGCTTGCGT
TC
AATGAAGTCCTGGCCAAGAGGAGCTACAAGCAGTTACGAGCCACCTTTCAAGCCTATCAAATTCTCAT
T
GGCAAAGACATAGAAGAAGCCATTGAAGAAGAAACATCAGGCGACTTGCAGAAGGCCTATTTAACTCTC
G
TG
AGATGTGCCCAGGATTGTGAGGACTATTTTGCTGAACGTCTGTACAAGTCGATGAAGGGTGCGGGGA
CC
GATGAGGAGACGTTGATTCGCATAGTCGTGACCAGGGCCGAGGTGGACCTTCAGGGGATCAAAGCAAA
G
TTCCAAGAGAAGTATCAGAAGTCTCTCTCTGACATGGTTCGCTCAGATACCTCCGGGGACTTCCGGAAA
CTG
CTAGTAGCCCTCTTGCACTGA


Translation (357 aa):
MGNRHSQSYTLSEGSQQLPKGDSQPSTVVQPLSHPSRNGEPEAPQPAKASSPQGFDVDRDAKKLNKACKG
M
GTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDRPSEYAARQLQKAM
K
GLGTDESVLIEVLCTRTNK
EIIAIKEAYQRLFDRSLESDVKGDTSGNLKKILVSLLQANRNEGDDVDKD
L
AGQDAKDLYD
AGEGRWGTDELAFNEVLAKRSYKQLRATFQAYQILIGKDIEEAIEEETSGDLQKAYLTL
V
RCAQDCEDYFAERLYKSMKGAGTDEETLIRIVVTRAEVDLQGIKAKFQEKYQKSLSDMVRSDTSGDFRK
L
LVALLH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser