NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8826.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8826.1 Public Homo sapiens 12 KRT82 22 109 92 CCDS HistoryNCBI Gene:3888Re-query CCDS DB by CCDS ID:8826.1Re-query CCDS DB by GeneID:3888See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8826.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000257974.2 ENSP00000257974.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000257974.2Link to Ensembl Protein Viewer:ENSP00000257974.2Re-query CCDS DB by Nucleotide ID:ENST00000257974Re-query CCDS DB by Protein ID:ENSP00000257974
Original member NCBI NM_033033.3 NP_149022.3 Updated not alive Link to Nucleotide Sequence:NM_033033.3Link to Protein Sequence:NP_149022.3Re-query CCDS DB by Nucleotide ID:NM_033033Re-query CCDS DB by Protein ID:NP_149022
Current member NCBI NM_033033.4 NP_149022.3 Accepted alive Link to Nucleotide Sequence:NM_033033.4Link to Protein Sequence:NP_149022.3Re-query CCDS DB by Nucleotide ID:NM_033033Re-query CCDS DB by Protein ID:NP_149022Link to BLAST:NP_149022.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_149022.3 513 Q9NSB4 513 100% 0 0

Chromosomal Locations for CCDS 8826.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52394975 52395195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52395759 52395790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52396012 52396232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52396883 52397008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52399985 52400149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52400527 52400622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52401289 52401349 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52403701 52403909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52405867 52406277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1542 nt):
ATGTCGTACCACTCTTTCCAGCCAGGCTCCAGGTGTGGCAGTCAGAGTTTCAGCTCATACTCGGCTGTCA
TG
CCCCGGATGGTCACCCACTATGCAGTGAGCAAGGGGCCATGCCGGCCCGGGGGTGGTAGGGGCCTCCG
A
GCTCTGGGCTGCCTTGGCTCACGGAGCCTGTGCAACGTGGGCTTTGGGAGGCCCCGGGTAGCCTCCAGG
TGT
GGAGGTACCCTGCCTGGCTTCGGGTACCGACTGGGAGCCACCTGTGGGCCTTCTGCCTGCATCACCC
CT
GTCACCATCAATGAGAGCCTGCTGGTCCCACTGGCACTGGAGATAGACCCGACTGTGCAGAGGGTAAA
G
AGGGATGAGAAGGAGCAGATCAAGTGCCTCAACAACCGTTTCGCATCTTTCATCAACAAGGTCCGTTTC
CTG
GAGCAGAAGAACAAGCTGCTGGAGACCAAGTGGAACTTCATGCAGCAGCAGAGGTGCTGCCAGACCA
AC
ATCGAGCCCATCTTCGAGGGCTATATCAGCGCCCTTCGGCGGCAGCTGGACTGTGTGTCCGGGGACCG
C
GTGAGGCTAGAGTCAGAGCTCTGCAGCCTCCAGGCTGCACTGGAGGGCTACAAGAAAAAATACGAAGAG
GAG
CTCTCCCTGCGTCCCTGTGTTGAGAATGAGTTTGTTGCCTTGAAGAAGGACGTGGACACAGCCTTCC
TG
ATGAAGGCTGACCTGGAGACCAACGCAGAGGCACTCGTGCAGGAGATCGACTTCCTGAAAAGCCTGTA
T
GAGGAGGAGATCTGCCTGCTCCAGTCTCAGATCTCTGAGACCTCGGTCATTGTGAAGATGGACAACAGC
CGG
GAGCTGGACGTGGACGGCATCATCGCTGAGATCAAGGCGCAGTATGACGACATCGCCAGCCGCAGCA
AA
GCCGAAGCAGAGGCCTGGTACCAGTGCCGGTATGAGGAGCTGAGAGTCACAGCTGGGAACCACTGTGA
C
AACCTCCGCAACCGTAAGAACGAGATCCTGGAAATGAATAAACTGATCCAGCGGCTGCAGCAAGAAACC
GAG
AATGTCAAAGCCCAGCGCTGCAAACTTGAGGGTGCCATAGCTGAGGCAGAGCAGCAGGGCGAGGCGG
CT
CTCAATGATGCCAAGTGCAAGCTGGCAGGGCTGGAGGAGGCTCTGCAGAAGGCCAAGCAGGACATGGC
C
TGCCTGCTCAAGGAATATCAGGAGGTGATGAACTCCAAGCTGGGCCTGGACATCGAGATCGCCACCTAC
AGG
CGCCTGCTGGAGGGTGAAGAGCACAGGCTGTGCGAAGGCATCGGGCCCGTGAATATCTCAGTGAGCA
GC
TCCAAAGGCGCCTTCCTGTACGAGCCATGTGGGGTCAGCACGCCTGTCCTCAGCACTGGCGTCCTCAG
G
AGCAATGGGGGCTGCAGCATCGTGGGCACTGGTGAACTCTATGTCCCCTGCGAGCCCCAGGGGCTACTG
AGC
TGTGGGAGCGGGCGGAAATCCAGCATGACGCTAGGAGCTGGGGGCAGCTCCCCCAGCCACAAGCATT
AG


Translation (513 aa):
MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASR
C
GGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINK
VRF
L
EQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKK
KYEE
E
LSLRPCVENEFVALKK
DVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNS
R
ELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCR
YEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQET
E
NVKAQ
RCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATY
R
RLLEGEEH
RLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLL
S
CGSGRKSSMTLGAGGSSPSHKH




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser