NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS5376.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5376.1 Public Homo sapiens 7 TOMM7 22 109 92 CCDS HistoryNCBI Gene:54543Re-query CCDS DB by CCDS ID:5376.1Re-query CCDS DB by GeneID:54543See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5376.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000358435.8 ENSP00000351214.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000358435.8Link to Ensembl Protein Viewer:ENSP00000351214.4Re-query CCDS DB by Nucleotide ID:ENST00000358435Re-query CCDS DB by Protein ID:ENSP00000351214
Original member NCBI NM_019059.3 NP_061932.1 Updated not alive Link to Nucleotide Sequence:NM_019059.3Link to Protein Sequence:NP_061932.1Re-query CCDS DB by Nucleotide ID:NM_019059Re-query CCDS DB by Protein ID:NP_061932
NCBI NM_019059.4 NP_061932.1 Updated not alive Link to Nucleotide Sequence:NM_019059.4Link to Protein Sequence:NP_061932.1Re-query CCDS DB by Nucleotide ID:NM_019059Re-query CCDS DB by Protein ID:NP_061932
Current member NCBI NM_019059.5 NP_061932.1 Accepted alive Link to Nucleotide Sequence:NM_019059.5Link to Protein Sequence:NP_061932.1Re-query CCDS DB by Nucleotide ID:NM_019059Re-query CCDS DB by Protein ID:NP_061932Link to BLAST:NP_061932.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_061932.1 55 Q9P0U1 55 100% 0 0

Chromosomal Locations for CCDS 5376.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 22813170 22813185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 22818000 22818048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 22822677 22822779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (168 nt):
ATGGTGAAGCTGAGCAAAGAGGCCAAGCAGAGACTACAGCAGCTCTTCAAGGGGAGCCAGTTTGCCATTC
GC
TGGGGCTTTATCCCTCTTGTGATTTACCTGGGATTTAAGAGGGGTGCAGATCCCGGAATGCCTGAACC
A
ACTGTTTTGAGCCTACTTTGGGGATAA


Translation (55 aa):
MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser