NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS11147.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
11147.1 Public Homo sapiens 17 PIK3R5 22 109 92 CCDS HistoryNCBI Gene:23533Re-query CCDS DB by CCDS ID:11147.1Re-query CCDS DB by GeneID:23533See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 11147.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000447110.5 ENSP00000392812.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000447110.5Link to Ensembl Protein Viewer:ENSP00000392812.1Re-query CCDS DB by Nucleotide ID:ENST00000447110Re-query CCDS DB by Protein ID:ENSP00000392812
Original member Current member EBI ENST00000581552.5 ENSP00000462433.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581552.5Link to Ensembl Protein Viewer:ENSP00000462433.1Re-query CCDS DB by Nucleotide ID:ENST00000581552Re-query CCDS DB by Protein ID:ENSP00000462433
Original member NCBI NM_001142633.2 NP_001136105.1 Updated not alive Link to Nucleotide Sequence:NM_001142633.2Link to Protein Sequence:NP_001136105.1Re-query CCDS DB by Nucleotide ID:NM_001142633Re-query CCDS DB by Protein ID:NP_001136105
Current member NCBI NM_001142633.3 NP_001136105.1 Accepted alive Link to Nucleotide Sequence:NM_001142633.3Link to Protein Sequence:NP_001136105.1Re-query CCDS DB by Nucleotide ID:NM_001142633Re-query CCDS DB by Protein ID:NP_001136105Link to BLAST:NP_001136105.1
Original member NCBI NM_014308.3 NP_055123.2 Updated not alive Link to Nucleotide Sequence:NM_014308.3Link to Protein Sequence:NP_055123.2Re-query CCDS DB by Nucleotide ID:NM_014308Re-query CCDS DB by Protein ID:NP_055123
Current member NCBI NM_014308.4 NP_055123.2 Accepted alive Link to Nucleotide Sequence:NM_014308.4Link to Protein Sequence:NP_055123.2Re-query CCDS DB by Nucleotide ID:NM_014308Re-query CCDS DB by Protein ID:NP_055123Link to BLAST:NP_055123.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001136105.1 880 Q8WYR1-1 880 100% 0 0
NP_055123.2 880 Q8WYR1-1 880 100% 0 0

Chromosomal Locations for CCDS 11147.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 8880639 8880786 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8880905 8881017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8881630 8881712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8881788 8881881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8884707 8884783 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8886229 8886322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8886477 8886605 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8887096 8887221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8887521 8887683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8888171 8888891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8889139 8889222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8889973 8890126 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8890738 8890912 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8893586 8893655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8904777 8904915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8905669 8905737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8909074 8909174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 8911392 8911494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2643 nt):
ATGCAGCCAGGGGCCACGACATGCACGGAGGACCGCATCCAGCATGCCCTGGAACGCTGCCTGCATGGAC
TC
AGCCTCAGCCGCCGCTCCACCTCCTGGTCAGCTGGGCTGTGTCTGAACTGCTGGAGCCTGCAGGAGCT
G
GTCAGCAGGGACCCGGGCCACTTCCTTATCCTCCTTGAGCAGATCCTGCAGAAGACCCGAGAGGTCCAG
GAG
AAGGGCACCTACGACCTGCTCACCCCGCTGGCCCTGCTCTTCTATTCCACTGTTCTTTGTACACCAC
AC
TTCCCACCAGACTCGGATCTCCTTCTGAAGGCAGCCAGCACCTACCACCGGTTCCTGACCTGGCCTGT
T
CCTTACTGCAGCATCTGCCAGGAGCTGCTCACCTTCATTGATGCTGAACTCAAGGCCCCAGGGATCTCC
TAC
CAGAGACTGGTGAGGGCTGAGCAGGGCCTGCCCATCAGGAGTCACCGCAGCTCCACCGTCACCGTGC
TG
CTGCTGAACCCAGTGGAAGTGCAGGCCGAGTTCCTTGCTGTAGCCAATAAGCTGAGTACGCCCGGACA
C
TCGCCTCACAGTGCCTACACCACCCTGCTCCTGCACGCCTTCCAGGCCACCTTTGGGGCCCACTGTGAC
GTC
CCGGGCCTGCACTGCAGGCTACAGGCCAAGACCCTGGCAGAGCTTGAGGACATCTTCACGGAGACCG
CA
GAGGCACAGGAGCTGGCATCTGGCATCGGGGATGCTGCAGAGGCCCGGCGGTGGCTCAGGACCAAGCT
G
CAGGCGGTGGGAGAAAAAGCTGGCTTCCCTGGGGTGTTAGACACTGCAAAACCAGGGAAGCTCCACACC
ATC
CCCATCCCTGTCGCCAGGTGCTACACCTACAGCTGGAGCCAGGACAGCTTTGACATCCTGCAGGAAA
TC
CTGCTCAAGGAACAGGAGCTACTCCAGCCAGGGATCCTGGGAGATGATGAAGAGGAGGAAGAGGAGGA
G
GAGGAGGTGGAGGAGGACTTGGAAACTGACGGGCACTGTGCCGAGAGAGATTCCCTGCTCTCCACCAGC
TCT
TTGGCGTCCCATGACTCCACCTTGTCCCTTGCATCCTCCCAGGCCTCGGGGCCGGCCCTCTCGCGCC
AT
CTGCTGACTTCCTTTGTCTCAGGCCTCTCTGATGGCATGGACAGCGGCTACGTGGAGGACAGCGAGGA
G
AGCTCCTCCGAGTGGCCTTGGAGGCGTGGCAGCCAGGAACGCCGAGGCCACCGCAGGCCTGGGCAGAAG
TTC
ATCAGGATCTATAAACTCTTCAAGAGCACCAGCCAGCTGGTACTGCGGAGGGACTCTCGGAGCCTGG
AG
GGCAGCTCGGACACGGCCCTGCCCCTGAGGCGGGCAGGGAGCCTCTGCAGCCCCCTGGACGAACCAGT
A
TCACCCCCTTCCCGGGCCCAGCGCTCCCGCTCCCTGCCCCAGCCCAAACTCGGTACCCAGCTGCCCAGC
TGG
CTTCTGGCCCCTGCTTCACGCCCCCAGCGCCGCCGCCCCTTCCTGAGTGGAGATGAGGATCCCAAGG
CT
TCCACGCTACGTGTTGTGGTCTTTGGCTCCGATCGGATTTCAGGGAAGGTGGCTCGGGCGTACAGCAA
C
CTTCGGCGGCTGGAGAACAATCGCCCACTCCTCACACGGTTCTTCAAACTTCAGTTCTTCTACGTGCCT
GTG
AAGCGAAGTCATGGGACCAGCCCTGGTGCCTGTCCACCCCCTCGGAGCCAGACGCCCTCACCCCCGA
CA
GACTCCCCTAGGCACGCCAGCCCTGGAGAGCTGGGCACCACCCCATGGGAGGAGAGCACCAATGACAT
C
TCCCACTACCTCGGCATGCTGGACCCCTGGTATGAGCGCAATGTACTGGGCCTCATGCACCTGCCCCCT
GAA
GTCCTGTGCCAGCAGTCCCTGAAGGCTGAAGCCCAGGCCCTGGAGGGCTCCCCAACCCAGCTGCCCA
TC
CTGGCTGACATGCTACTCTACTACTGCCGCTTTGCCGCCAGACCGGTGCTGCTGCAAGTCTATCAGAC
C
GAGCTGACCTTCATCACTGGGGAGAAGACGACAGAGATCTTCATCCACTCCTTGGAGCTGGGTCACTCC
GCT
GCCACACGTGCCATCAAGGCGTCAGGTCCTGGCAGCAAGCGGCTGGGCATCGATGGCGACCGGGAGG
CT
GTTCCTCTAACACTACAGATTATTTACAGCAAGGGGGCCATCAGTGGACGAAGTCGCTGGAGCAACCT
G
GAGAAGGTCTGTACCTCCGTGAACCTCAACAAGGCCTGCCGGAAGCAGGAGGAGCTGGATTCCAGCATG
GAG
GCCCTGACGCTAAACCTGACAGAAGTGGTGAAAAGGCAGAACTCCAAATCCAAGAAGGGCTTTAACC
AG
ATTAGCACATCGCAGATCAAAGTGGACAAGGTGCAGATCATCGGCTCCAACAGCTGCCCCTTTGCTGT
G
TGCCTGGACCAGGATGAGAGAAAGATCCTGCAGAGTGTAGTCAGATGTGAGGTCTCACCGTGCTACAAG
CCA
GAGAAGAGCGACCTCTCCTCACCACCCCAGACGCCTCCTGACCTGCCGGCCCAGGCCGCACCTGATC
TC
TGCTCCCTTCTCTGCCTGCCCATCATGACTTTCAGTGGAGCTCTGCCCTAG


Translation (880 aa):
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLEQILQKTREVQ
E
KGTYDLLTPLALLFYSTVLC
TPHFPPDSDLLLKAASTYHRFLTWPVPYCSICQELLTFIDAELKAPGIS
Y
QRLVRAEQGLPIRSHRSST
VTVLLLNPVEVQAEFLAVANKLSTPGHSPHSAYTTLLLHAFQATFGAHCD
V
PGLHCRLQ
AKTLAELEDIFTETAEAQELASGIGDAAEARRWLRTKLQAVGEKAGFPGVLDTAKPGKLHT
I
PIPVARCYTYSWSQDSF
DILQEILLKEQELLQPGILGDDEEEEEEEEEVEEDLETDGHCAERDSLLSTS
S
LASHDSTLSLASSQASGPALSRHLLTSFVSGLSDGMDSGYVEDSEESSSEWPWRRGSQERRGHRRPGQK
F
IRIYKLFKSTSQLVLRRDSRSLEGSSDTALPLRRAGSLCSPLDEPVSPPSRAQRSRSLPQPKLGTQLPS
W
LLAPASRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNL
RRLENNRPLLTRFFKLQFFYVP
V
KRSHGTSPGACPPPRSQTPSPPTDSPRHASPG
ELGTTPWEESTNDISHYLGMLDPWYERNVLGLMHLPP
E
VLCQ
QSLKAEAQALEGSPTQLPILADMLLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHS
A
ATRAIKAS
GPGSKRLGIDGDREAVPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRKQEELDSSM
E
ALTLNLTEVVKRQNSKSKKGFNQ
ISTSQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPCYK
P
EKSDLSSPPQTPPDLPAQAAPDLCSLLCLPIMTFSGALP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser