NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS8531.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8531.1 Public Homo sapiens 12 AKAP3 22 109 92 CCDS HistoryNCBI Gene:10566Re-query CCDS DB by CCDS ID:8531.1Re-query CCDS DB by GeneID:10566See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8531.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000228850.5 ENSP00000228850.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000228850.5Link to Ensembl Protein Viewer:ENSP00000228850.1Re-query CCDS DB by Nucleotide ID:ENST00000228850Re-query CCDS DB by Protein ID:ENSP00000228850
Original member Current member EBI ENST00000545990.6 ENSP00000440994.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545990.6Link to Ensembl Protein Viewer:ENSP00000440994.1Re-query CCDS DB by Nucleotide ID:ENST00000545990Re-query CCDS DB by Protein ID:ENSP00000440994
Original member NCBI NM_001278309.1 NP_001265238.1 Updated not alive Link to Nucleotide Sequence:NM_001278309.1Link to Protein Sequence:NP_001265238.1Re-query CCDS DB by Nucleotide ID:NM_001278309Re-query CCDS DB by Protein ID:NP_001265238
Current member NCBI NM_001278309.2 NP_001265238.2 Accepted alive Link to Nucleotide Sequence:NM_001278309.2Link to Protein Sequence:NP_001265238.2Re-query CCDS DB by Nucleotide ID:NM_001278309Re-query CCDS DB by Protein ID:NP_001265238Link to BLAST:NP_001265238.2
Original member NCBI NM_006422.3 NP_006413.3 Updated not alive Link to Nucleotide Sequence:NM_006422.3Link to Protein Sequence:NP_006413.3Re-query CCDS DB by Nucleotide ID:NM_006422Re-query CCDS DB by Protein ID:NP_006413
Current member NCBI NM_006422.4 NP_006413.4 Accepted alive Link to Nucleotide Sequence:NM_006422.4Link to Protein Sequence:NP_006413.4Re-query CCDS DB by Nucleotide ID:NM_006422Re-query CCDS DB by Protein ID:NP_006413Link to BLAST:NP_006413.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265238.2 853 O75969 853 100% 0 0
NP_006413.4 853 O75969 853 100% 0 0

Chromosomal Locations for CCDS 8531.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 4615739 4615894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4626496 4628805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 4638101 4638196 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2562 nt):
ATGTCAGAAAAGGTTGACTGGTTACAAAGCCAAAATGGAGTATGCAAAGTTGATGTCTATTCTCCTGGAG
AC
AACCAAGCCCAGGACTGGAAAATGGACACCTCCACGGATCCTGTCAGAGTGCTCAGCTGGCTCCGCAG
A
GACCTGGAGAAGAGTACAGCAGAGTTCCAAGATGTTCGGTTCAAACCCGGAGAATCATTTGGTGGGGAA
ACG
TCCAACTCAGGAGACCCACACAAAGGTTTCTCTGTAGACTATTACAACACCACCACCAAGGGCACTC
CA
GAAAGATTGCATTTTGAGATGACTCACAAAGAGATTCCTTGCCAGGGCCCCAGGGCCCAACTTGGCAA
C
GGGAGTTCAGTAGATGAAGTTTCCTTCTATGCTAACCGCCTCACGAATCTAGTCATAGCCATGGCCCGC
AAA
GAGATCAATGAGAAGATCGATGGCTCTGAAAACAAATGTGTCTATCAGTCATTGTACATGGGGAATG
AA
CCCACACCCACCAAAAGCCTCAGTAAGATAGCATCAGAGCTTGTGAATGAGACCGTCTCTGCATGTTC
C
AGGAATGCTGCCCCAGACAAGGCTCCTGGCTCTGGAGACAGAGTCTCGGGATCATCACAAAGTCCCCCA
AAT
TTGAAATACAAGTCCACTTTGAAGATCAAGGAGAGCACCAAAGAAAGACAGGGTCCAGATGACAAGC
CT
CCTTCTAAGAAGTCTTTCTTCTATAAGGAAGTGTTTGAATCTCGTAATGGAGATTATGCCAGAGAGGG
T
GGAAGGTTCTTTCCTCGGGAGAGAAAGAGGTTTCGAGGGCAGGAAAGGCCTGATGACTTTACGGCTTCT
GTT
AGTGAAGGGATCATGACCTATGCTAACAGTGTGGTATCTGATATGATGGTCTCCATCATGAAGACAC
TG
AAGATCCAAGTGAAAGACACAACCATTGCCACCATCCTACTGAAGAAGGTTCTGCTCAAGCATGCAAA
A
GAGGTGGTCTCGGATCTCATCGACTCCTTCTTGAGGAATCTCCACAGCGTCACAGGGACCCTCATGACT
GAC
ACACAGTTTGTCTCGGCTGTGAAAAGAACTGTCTTCTCTCATGGAAGCCAAAAGGCCACAGATATCA
TG
GATGCCATGCTAAGGAAGCTGTACAATGTAATGTTTGCCAAGAAAGTCCCTGAGCATGTCAGGAAAGC
C
CAAGACAAGGCTGAGAGTTATTCCCTCATCTCCATGAAAGGAATGGGTGATCCTAAAAACCGAAATGTG
AAC
TTTGCCATGAAATCTGAAACTAAATTGAGAGAAAAAATGTATTCTGAACCCAAATCAGAGGAGGAGA
CT
TGTGCGAAAACTCTGGGTGAGCACATTATCAAAGAGGGGCTTACCTTGTGGCATAAAACTCAGCAGAA
A
GAATGTAAATCTCTAGGTTTCCAGCATGCAGCATTTGAAGCTCCCAACACACAGCGTAAGCCTGCATCA
GAC
ATTTCCTTTGAGTACCCTGAAGATATTGGCAACCTCAGCCTTCCTCCATATCCTCCAGAGAAACCTG
AG
AATTTTATGTATGATTCAGACTCCTGGGCCGAGGACCTGATCGTGTCTGCCCTGCTTCTGATTCAATA
T
CACCTGGCCCAGGGAGGAAGAAGGGATGCACGGAGCTTCGTTGAAGCTGCTGGCACCACCAACTTTCCT
GCC
AATGAACCTCCTGTAGCTCCCGATGAATCTTGCCTTAAGTCTGCTCCCATTGTAGGTGACCAAGAAC
AA
GCAGAAAAGAAGGACCTAAGGAGTGTTTTCTTTAATTTCATCCGGAACTTACTTAGTGAGACCATTTT
C
AAGCGTGACCAGAGCCCTGAACCCAAGGTGCCGGAACAGCCAGTTAAGGAAGATAGGAAGTTGTGTGAA
AGA
CCGTTGGCGTCTTCTCCCCCCAGGCTATATGAGGATGATGAGACCCCTGGTGCCCTTTCTGGGCTGA
CC
AAGATGGCTGTCAGCCAGATAGATGGCCACATGAGTGGGCAGATGGTAGAACATCTGATGAACTCAGT
G
ATGAAGCTGTGTGTCATCATTGCTAAGTCCTGTGATGCTTCGTTGGCAGAGCTGGGAGATGACAAGTCT
GGA
GATGCCAGTAGGCTAACTTCGGCCTTCCCAGATAGTTTATATGAGTGCTTACCAGCCAAGGGCACAG
GG
TCAGCAGAAGCTGTCCTGCAGAATGCCTATCAAGCTATCCATAATGAAATGAGAGGCACATCAGGACA
G
CCCCCTGAAGGGTGTGCAGCACCCACGGTGATTGTCAGCAATCACAACCTAACGGACACAGTTCAGAAC
AAG
CAACTCCAAGCCGTCCTTCAATGGGTAGCTGCCTCTGAGCTCAATGTCCCTATTTTGTATTTTGCTG
GT
GATGATGAAGGGATCCAGGAGAAGCTACTTCAGCTCTCAGCTGCTGCTGTGGACAAAGGATGCAGTGT
G
GGCGAGGTTCTGCAGTCGGTGCTGCGCTATGAGAAGGAGCGCCAGCTGAATGAGGCGGTGGGGAATGTC
ACA
CCGCTGCAGCTGCTGGACTGGCTGATGGTGAACCTGTAA


Translation (853 aa):
MSEKVDWLQSQNGVCKVDVYSPGDNQAQDWKMDTSTDPVRVLSWLRRDLEKSTAEFQDVRFKPGESFGGE
T
SNSGDPHKGFSVDYYNTTTKGTPERLHFEMTHKEIPCQGPRAQLGNGSSVDEVSFYANRLTNLVIAMAR
K
EINEKIDGSENKCVYQSLYMGNEPTPTKSLSKIASELVNETVSACSRNAAPDKAPGSGDRVSGSSQSPP
N
LKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEVFESRNGDYAREGGRFFPRERKRFRGQERPDDFTAS
V
SEGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLLKHAKEVVSDLIDSFLRNLHSVTGTLMT
D
TQFVSAVKRTVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNV
N
FAMKSETKLREKMYSEPKSEEETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFEAPNTQRKPAS
D
ISFEYPEDIGNLSLPPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLAQGGRRDARSFVEAAGTTNFP
A
NEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCE
R
PLASSPPRLYEDDETPGALSGLTKMAVSQIDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAELGDDKS
G
DASRLTSAFPDSLYECLPAKGTGSAEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQN
K
QLQAVLQWVAASELNVPILYFAGDDEGIQEK
LLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNV
T
PLQLLDWLMVNL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser