NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS73471.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73471.1 Public Homo sapiens 12 NR4A1 22 109 92 CCDS HistoryNCBI Gene:3164Re-query CCDS DB by CCDS ID:73471.1Re-query CCDS DB by GeneID:3164See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 73471.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000545748.5 ENSP00000440864.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545748.5Link to Ensembl Protein Viewer:ENSP00000440864.1Re-query CCDS DB by Nucleotide ID:ENST00000545748Re-query CCDS DB by Protein ID:ENSP00000440864
Original member NCBI NM_001202234.1 NP_001189163.1 Updated not alive Link to Nucleotide Sequence:NM_001202234.1Link to Protein Sequence:NP_001189163.1Re-query CCDS DB by Nucleotide ID:NM_001202234Re-query CCDS DB by Protein ID:NP_001189163
Current member NCBI NM_001202234.2 NP_001189163.1 Accepted alive Link to Nucleotide Sequence:NM_001202234.2Link to Protein Sequence:NP_001189163.1Re-query CCDS DB by Nucleotide ID:NM_001202234Re-query CCDS DB by Protein ID:NP_001189163Link to BLAST:NP_001189163.1

Chromosomal Locations for CCDS 73471.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 52038710 52038749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52041810 52041929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52054327 52055204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52056030 52056159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52056494 52056645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52057057 52057259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52057352 52057530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 52058688 52058944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1959 nt):
ATGACAAGTGCACAGTATAAAATCAAGATTCTAATTGAAGGCCTCCACCATGGACAGAGGCCAGGCCCTG
CC
CCTCCCAGGCAGCCTGGCTCCTTCTGCTGGGCCCTGAAGGCAGACGGGATAATGTGGTTGGCCAAGGC
C
TGTTGGTCCATCCAGAGTGAGATGCCCTGTATCCAAGCCCAATATGGGACACCAGCACCGAGTCCGGGA
CCC
CGTGACCACCTGGCAAGCGACCCCCTGACCCCTGAGTTCATCAAGCCCACCATGGACCTGGCCAGCC
CC
GAGGCAGCCCCCGCTGCCCCCACTGCCCTGCCCAGCTTCAGCACCTTCATGGACGGCTACACAGGAGA
G
TTTGACACCTTCCTCTACCAGCTGCCAGGAACAGTCCAGCCATGCTCCTCAGCCTCCTCCTCGGCCTCC
TCC
ACATCCTCGTCCTCAGCCACCTCCCCTGCCTCTGCCTCCTTCAAGTTCGAGGACTTCCAGGTGTACG
GC
TGCTACCCCGGCCCCCTGAGCGGCCCAGTGGATGAGGCCCTGTCCTCCAGTGGCTCTGACTACTATGG
C
AGCCCCTGCTCGGCCCCGTCGCCCTCCACGCCCAGCTTCCAGCCGCCCCAGCTCTCTCCCTGGGATGGC
TCC
TTCGGCCACTTCTCGCCCAGCCAGACTTACGAAGGCCTGCGGGCATGGACAGAGCAGCTGCCCAAAG
CC
TCTGGGCCCCCACAGCCTCCAGCCTTCTTTTCCTTCAGTCCTCCCACCGGCCCCAGCCCCAGCCTGGC
C
CAGAGCCCCCTGAAGTTGTTCCCCTCACAGGCCACCCACCAGCTGGGGGAGGGAGAGAGCTATTCCATG
CCT
ACGGCCTTCCCAGGTTTGGCACCCACTTCTCCACACCTTGAGGGCTCGGGGATACTGGATACACCCG
TG
ACCTCAACCAAGGCCCGGAGCGGGGCCCCAGGTGGAAGTGAAGGCCGCTGTGCTGTGTGTGGGGACAA
C
GCTTCATGCCAGCATTATGGTGTCCGCACATGTGAGGGCTGCAAGGGCTTCTTCAAGCGCACAGTGCAG
AAA
AACGCCAAGTACATCTGCCTGGCTAACAAGGACTGCCCTGTGGACAAGAGGCGGCGAAACCGCTGCC
AG
TTCTGCCGCTTCCAGAAGTGCCTGGCGGTGGGCATGGTGAAGGAAGTTGTCCGAACAGACAGCCTGAA
G
GGGCGGCGGGGCCGGCTACCTTCAAAACCCAAGCAGCCCCCAGATGCCTCCCCTGCCAATCTCCTCACT
TCC
CTGGTCCGTGCACACCTGGACTCAGGGCCCAGCACTGCCAAACTGGACTACTCCAAGTTCCAGGAGC
TG
GTGCTGCCCCACTTTGGGAAGGAAGATGCTGGGGATGTACAGCAGTTCTACGACCTGCTCTCCGGTTC
T
CTGGAGGTCATCCGCAAGTGGGCGGAGAAGATCCCTGGCTTTGCTGAGCTGTCACCGGCTGACCAGGAC
CTG
TTGCTGGAGTCGGCCTTCCTGGAGCTCTTCATCCTCCGCCTGGCGTACAGGTCTAAGCCAGGCGAGG
GC
AAGCTCATCTTCTGCTCAGGCCTGGTGCTACACCGGCTGCAGTGTGCCCGTGGCTTCGGGGACTGGAT
T
GACAGTATCCTGGCCTTCTCAAGGTCCCTGCACAGCTTGCTTGTCGATGTCCCTGCCTTCGCCTGCCTC
TCT
GCCCTTGTCCTCATCACCGACCGGCATGGGCTGCAGGAGCCGCGGCGGGTGGAGGAGCTGCAGAACC
GC
ATCGCCAGCTGCCTGAAGGAGCACGTGGCAGCTGTGGCGGGCGAGCCCCAGCCAGCCAGCTGCCTGTC
A
CGTCTGTTGGGCAAACTGCCCGAGCTGCGGACCCTGTGCACCCAGGGCCTGCAGCGCATCTTCTACCTC
AAG
CTGGAGGACTTGGTGCCCCCTCCACCCATCATTGACAAGATCTTCATGGACACGCTGCCCTTCTGA


Translation (652 aa):
MTSAQYKIKILIEGLHHGQRPGPAPPRQPGSFCWALKADGIMWLAKACWSIQSEMPCIQAQYGTPAPSPG
P
RDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSAS
S
TSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDG
S
FGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSM
P
TAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFK
RTVQ
K
NAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKE
VVRTDSLKGRRGRLPSKPKQPPDASPANLLT
S
LVRAHLDSGPSTAKLDYSK
FQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQD
L
LLESAFLELFILRLAY
RSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACL
S
ALVLIT
DRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYL
K
LEDLVPPPPIIDKIFMDTLPF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser