NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS28552.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
28552.1 Public Mus musculus 17 Dusp1 23 108 98 CCDS HistoryNCBI Gene:19252Re-query CCDS DB by CCDS ID:28552.1Re-query CCDS DB by GeneID:19252See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 28552.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000025025.6 ENSMUSP00000025025.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025025.6Link to Ensembl Protein Viewer:ENSMUSP00000025025.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000025025Re-query CCDS DB by Protein ID:ENSMUSP00000025025
Original member Current member NCBI NM_013642.3 NP_038670.1 Accepted alive Link to Nucleotide Sequence:NM_013642.3Link to Protein Sequence:NP_038670.1Re-query CCDS DB by Nucleotide ID:NM_013642Re-query CCDS DB by Protein ID:NP_038670Link to BLAST:NP_038670.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_038670.1 367 P28563 367 100% 0 0

Chromosomal Locations for CCDS 28552.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 26506280 26506650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26506985 26507204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26507574 26507719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26507957 26508323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1104 nt):
ATGGTGATGGAGGTGGGCATCCTGGACGCCGGGGGGCTGCGCGCGCTGCTGCGAGAGGGCGCCGCGCAGT
GC
CTGTTGTTGGATTGTCGCTCCTTCTTCGCTTTCAACGCCGGCCACATCGCGGGCTCAGTGAACGTGCG
C
TTCAGCACCATCGTGCGGCGCCGCGCCAAGGGCGCCATGGGCCTGGAGCATATCGTGCCCAACGCTGAA
CTG
CGTGGCCGCCTGCTGGCCGGAGCCTACCACGCCGTGGTGCTGCTGGACGAGCGCAGCGCCTCCCTGG
AC
GGCGCCAAGCGCGACGGCACCCTGGCCCTGGCCGCGGGCGCGCTCTGCCGAGAGGCGCGCTCCACTCA
A
GTCTTCTTTCTCCAAGGAGGATATGAAGCGTTTTCGGCTTCCTGCCCTGAGCTGTGCAGCAAACAGTCC
ACC
CCCACGGGGCTCAGCCTCCCCCTGAGTACTAGTGTGCCTGACAGTGCAGAATCCGGATGCAGCTCCT
GT
AGTACCCCTCTCTACGATCAGGGGGGCCCAGTGGAGATCCTGTCCTTCCTGTACCTGGGCAGTGCCTA
T
CACGCTTCTCGGAAGGATATGCTTGACGCCTTGGGCATCACCGCCTTGATCAACGTCTCAGCCAATTGT
CCT
AACCACTTTGAGGGTCACTACCAGTACAAGAGCATCCCTGTGGAGGACAACCACAAGGCAGACATCA
GC
TCCTGGTTCAACGAGGCTATTGACTTCATAGACTCCATCAAGGATGCTGGAGGGAGAGTGTTTGTTCA
T
TGCCAGGCCGGCATCTCCCGGTCAGCCACCATCTGCCTTGCTTACCTCATGAGGACTAACCGGGTAAAG
CTG
GACGAGGCCTTTGAGTTTGTGAAGCAGAGGCGGAGTATCATCTCCCCGAACTTCAGCTTCATGGGCC
AG
CTGCTGCAGTTTGAGTCCCAAGTGCTAGCCCCTCACTGCTCTGCTGAAGCTGGGAGCCCTGCCATGGC
T
GTCCTTGACCGGGGCACCTCTACTACCACAGTCTTCAACTTCCCTGTTTCCATCCCCGTCCACCCCACG
AAC
AGTGCCCTGAACTACCTTAAAAGCCCCATCACCACCTCTCCAAGCTGCTGA


Translation (367 aa):
MVMEVGILDAGGLRALLREGAAQCLLLDCRSFFAFNAGHIAGSVNVRFSTIVRRRAKGAMGLEHIVPNAE
L
RGRLLAGAYHAVVLLDERSASLDGAKRDGTLALAAGALCREARSTQVFFLQ
GGYEAFSASCPELCSKQS
T
PTGLSLPLSTSVPDSAESGCSSCSTPLYDQ
GGPVEILSFLYLGSAYHASRKDMLDALGITALINVSANC
P
NHFEGHYQYKSIPVEDNHKADISSWFNEAIDFI
DSIKDAGGRVFVHCQAGISRSATICLAYLMRTNRVK
L
DEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHPT
N
SALNYLKSPITTSPSC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser