NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS29850.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29850.1 Public Mus musculus 19 Scd1 23 108 98 CCDS HistoryNCBI Gene:20249Re-query CCDS DB by CCDS ID:29850.1Re-query CCDS DB by GeneID:20249See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 29850.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000041331.3 ENSMUSP00000036936.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041331.3Link to Ensembl Protein Viewer:ENSMUSP00000036936.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000041331Re-query CCDS DB by Protein ID:ENSMUSP00000036936
Original member Current member NCBI NM_009127.4 NP_033153.2 Accepted alive Link to Nucleotide Sequence:NM_009127.4Link to Protein Sequence:NP_033153.2Re-query CCDS DB by Nucleotide ID:NM_009127Re-query CCDS DB by Protein ID:NP_033153Link to BLAST:NP_033153.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033153.2 355 P13516 355 100% 0 0

Chromosomal Locations for CCDS 29850.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 44397919 44398118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44400142 44400374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44401693 44401898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44403165 44403295 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44406487 44406760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 44407386 44407409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1068 nt):
ATGCCGGCCCACATGCTCCAAGAGATCTCCAGTTCTTACACGACCACCACCACCATCACTGCACCTCCCT
CC
GGAAATGAACGAGAGAAGGTGAAGACGGTGCCCCTCCACCTGGAAGAAGACATCCGTCCTGAAATGAA
A
GAAGATATTCACGACCCCACCTATCAGGATGAGGAGGGACCCCCGCCCAAGCTGGAGTACGTCTGGAGG
AAC
ATCATTCTCATGGTCCTGCTGCACTTGGGAGGCCTGTACGGGATCATACTGGTTCCCTCCTGCAAGC
TC
TACACCTGCCTCTTCGGGATTTTCTACTACATGACCAGCGCTCTGGGCATCACAGCCGGGGCTCATCG
C
CTCTGGAGCCACAGAACTTACAAGGCACGGCTGCCCCTGCGGATCTTCCTTATCATTGCCAACACCATG
GCG
TTCCAGAATGACGTGTACGAATGGGCCCGAGATCACCGCGCCCACCACAAGTTCTCAGAAACACACG
CC
GACCCTCACAATTCCCGCCGTGGCTTCTTCTTCTCTCACGTGGGTTGGCTGCTTGTGCGCAAACACCC
G
GCTGTCAAAGAGAAGGGCGGAAAACTGGACATGTCTGACCTGAAAGCCGAGAAGCTGGTGATGTTCCAG
AGG
AGGTACTACAAGCCCGGCCTCCTGCTGATGTGCTTCATCCTGCCCACGCTGGTGCCCTGGTACTGCT
GG
GGCGAGACTTTTGTAAACAGCCTGTTCGTTAGCACCTTCTTGCGATACACTCTGGTGCTCAACGCCAC
C
TGGCTGGTGAACAGTGCCGCGCATCTCTATGGATATCGCCCCTACGACAAGAACATTCAATCCCGGGAG
AAT
ATCCTGGTTTCCCTGGGTGCCGTGGGCGAGGGCTTCCACAACTACCACCACACCTTCCCCTTCGACT
AC
TCTGCCAGTGAGTACCGCTGGCACATCAACTTCACCACGTTCTTCATCGACTGCATGGCTGCCCTGGG
C
CTGGCTTACGACCGGAAGAAAGTTTCTAAGGCTACTGTCTTAGCCAGGATTAAGAGAACTGGAGACGGG
AGT
CACAAGAGTAGCTGA


Translation (355 aa):
MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDIHDPTYQDEEGPPPKLEYVWR
N
IILMVLLHLGGLYGIILVPSCKLYTCLF
GIFYYMTSALGITAGAHRLWSHRTYKARLPLRIFLIIANTM
A
FQ
NDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGWLLVRKHPAVKEKGGKLDMSDLKAEKLVMFQ
R
RYYKPGLLLMCFILPTLVPWYCWGETFVNSLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRE
N
ILVSLGAV
GEGFHNYHHTFPFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDG
S
HKSS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser