NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS22040.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
22040.1 Public Mus musculus 7 Cdkn1c 23 108 98 CCDS HistoryNCBI Gene:12577Re-query CCDS DB by CCDS ID:22040.1Re-query CCDS DB by GeneID:12577See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 22040.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000037287.7 ENSMUSP00000037302.6 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000037287.7Link to Ensembl Protein Viewer:ENSMUSP00000037302.6Re-query CCDS DB by Nucleotide ID:ENSMUST00000037287Re-query CCDS DB by Protein ID:ENSMUSP00000037302
Original member Current member NCBI NM_001354981.1 NP_001341910.1 Accepted alive Link to Nucleotide Sequence:NM_001354981.1Link to Protein Sequence:NP_001341910.1Re-query CCDS DB by Nucleotide ID:NM_001354981Re-query CCDS DB by Protein ID:NP_001341910Link to BLAST:NP_001341910.1
Original member Current member NCBI NM_009876.4 NP_034006.3 Accepted alive Link to Nucleotide Sequence:NM_009876.4Link to Protein Sequence:NP_034006.3Re-query CCDS DB by Nucleotide ID:NM_009876Re-query CCDS DB by Protein ID:NP_034006Link to BLAST:NP_034006.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001341910.1 335 P49919-2 335 100% 0 0
NP_034006.3 335 P49919-2 335 100% 0 0

Chromosomal Locations for CCDS 22040.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 143459117 143459250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 143459795 143460668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1008 nt):
ATGGAACGCTTGGCCTCCAGCGATACCTTCCCAGTGATAGCGCGTAGCAGCGCCTGCCGCAGCCTCTTCG
GG
CCTGTAGACCACGAGGAGCTGGGCCGCGAGCTGCGGATGCGCCTGGCCGAGCTGAACGCCGAGGACCA
G
AACCGCTGGGACTTCAACTTCCAGCAGGATGTGCCTCTTCGAGGCCCTGGTCGTCTGCAGTGGATGGAG
GTG
GACAGCGAGTCTGTGCCCGCCTTCTACCGCGAGACGGTGCAGGTGGGGCGCTGTCGCCTGCAGCTGG
GG
CCCCGGCCACCCCCGGTGGCCGTGGCTGTCATCCCGCGTTCTGGGCCGCCGGCTGGCGAGGCCCCCGA
C
GGCCTAGAGGAGGCGCCTGAGCAGCCGCCCAGCGCCCCAGCCTCGGCCGTGGTCGCGGAGCCCACCCCA
CCC
GCGACCCCGGCCCCGGCTTCAGATCTGACCTCAGACCCAATTCCGGAGGTGACCCTGGTCGCGACCT
CC
GACCCGACTCCGGACCCGATCCCGGACGCGAACCCGGACGTGGCGACTCGGGACGGCGAGGAACAGGT
C
CCTGAGCAGGTCTCTGAGCAGGGCGAGGAGTCGGGTGCTGAGCCGGGTGATGAGCTGGGAACTGAGCCG
GTC
TCTGAGCAGGGCGAGGAGCAGGGCGCAGAGCCGGTCGAGGAGAAGGACGAGGAGCCGGAGGAGGAGC
AG
GGCGCGGAGCCGGTCGAGGAGCAGGGTGCGGAGCCGGTCGAGGAGCAGAATGGGGAGCCGGTCGAGGA
G
CAGGACGAGAATCAAGAGCAGCGCGGCCAGGAGCTGAAGGACCAGCCTCTCTCGGGGATTCCAGGACGT
CCT
GCACCCGGGACTGCTGCGGCCAATGCGAACGACTTCTTCGCCAAGCGCAAGAGAACTGCGCAGGAGA
AC
AAGGCGTCGAACGACGTCCCTCCAGGGTGTCCCTCTCCAAACGTGGCTCCTGGGGTGGGCGCGGTGGA
G
CAGACCCCGCGCAAACGTCTGAGATGA


Translation (335 aa):
MERLASSDTFPVIARSSACRSLFGPVDHEELGRELRMRLAELNAEDQNRWDFNFQQDVPLRGPGRLQWME
V
DSESVPAFYRETVQVGRCRLQLGPRPPPVAVAVIPRSGPPAGEAPDGLEEAPEQPPSAPASAVVAEPTP
P
ATPAPASDLTSDPIPEVTLVATSDPTPDPIPDANPDVATRDGEEQVPEQVSEQGEESGAEPGDELGTEP
V
SEQGEEQGAEPVEEKDEEPEEEQGAEPVEEQGAEPVEEQNGEPVEEQDENQEQRGQELKDQPLSGIPGR
P
APGTAAANAN
DFFAKRKRTAQENKASNDVPPGCPSPNVAPGVGAVEQTPRKRLR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser