NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS38284.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38284.1 Public Mus musculus 2 Hck 23 108 98 CCDS HistoryNCBI Gene:15162Re-query CCDS DB by CCDS ID:38284.1Re-query CCDS DB by GeneID:15162See the combined annotation on chromosome 2 in Sequence Viewer

Public Note for CCDS 38284.1
This CCDS ID represents the longer mouse Hck isoform, known as p59Hck, as described in PMID:1875927. This isoform initiates translation from a non-AUG (CUG) start codon that is well-conserved and present in a strong Kozak signal context. Alternative translation initiation from a downstream AUG start codon produces an isoform that is 21 aa shorter at the N-terminus. The shorter isoform, which is known as p56Hck, is represented by CCDS 50756.1. These isoforms exhibit distinct subcellular localization, as indicated in PMID:1875927.

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Non-AUG initiation codon

Sequence IDs included in CCDS 38284.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENSMUST00000003370.13 ENSMUSP00000003370.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000003370.13Link to Ensembl Protein Viewer:ENSMUSP00000003370.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000003370Re-query CCDS DB by Protein ID:ENSMUSP00000003370
Original member Current member EBI ENSMUST00000191431.7 ENSMUSP00000139988.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000191431.7Link to Ensembl Protein Viewer:ENSMUSP00000139988.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000191431Re-query CCDS DB by Protein ID:ENSMUSP00000139988
Original member Current member NCBI NM_010407.4 NP_034537.2 Accepted alive Link to Nucleotide Sequence:NM_010407.4Link to Protein Sequence:NP_034537.2Re-query CCDS DB by Nucleotide ID:NM_010407Re-query CCDS DB by Protein ID:NP_034537Link to BLAST:NP_034537.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034537.2 524 P08103-1 524 100% 0 0

Chromosomal Locations for CCDS 38284.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 153108693 153108754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153124170 153124287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153128263 153128305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153129043 153129142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153129844 153129942 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153131221 153131324 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153134069 153134218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153134624 153134776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153136698 153136877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153138262 153138338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153144419 153144572 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153148947 153149078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 153150947 153151149 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair. This works on the replacement symbol in the Translation Exceptions section also.

Translation Exceptions:
replace the symbol L (codon CTG) with M at amino acid position 1

Nucleotide Sequence (1575 nt):
CTGGGGGGTCGGTCTAGCTGCGAGGATCCGGGCTGCCCACGAAGCGAAGGGCGGGCGCCCAGGATGGGAT
GC
GTGAAGTCCAGGTTCCTCCGAGATGGAAGCAAGGCCTCAAAAACAGAGCCAAGTGCCAATCAGAAGGG
C
CCTGTGTATGTGCCGGATCCCACGTCCTCCAGCAAGCTGGGACCAAACAACAGCAACAGCATGCCCCCA
GGG
TTTGTGGAGGGCTCTGAGGATACCATTGTGGTCGCACTGTACGACTATGAGGCTATTCACCGTGAAG
AC
CTCAGCTTCCAGAAGGGAGACCAGATGGTGGTTCTGGAGGAGGCTGGGGAGTGGTGGAAGGCACGGTC
C
CTGGCTACCAAGAAGGAAGGCTACATCCCAAGCAACTATGTGGCTCGAGTTAACTCTTTGGAGACAGAA
GA
G
TGGTTCTTCAAGGGGATCAGCCGGAAGGATGCAGAGCGCCACCTCCTGGCTCCAGGCAACATGCTGG
GC
TCCTTCATGATCCGGGACAGTGAGACCACCAAAGGGAGCTACTCGTTGTCTGTTCGAGACTTTGACCC
C
CAGCACGGAGACACCGTGAAGCACTATAAGATCCGGACGCTGGACAGTGGAGGCTTCTACATCTCTCCA
AGG
AGCACCTTCAGCAGCCTGCAGGAACTCGTGCTCCACTACAAGAAGGGGAAGGATGGGCTCTGCCAGA
AG
CTGTCAGTGCCCTGTGTGTCTCCCAAACCCCAGAAGCCATGGGAGAAAGATGCTTGGGAGATTCCTCG
A
GAATCCCTCCAGATGGAGAAGAAACTTGGAGCTGGGCAGTTTGGAGAAGTGTGGATGGCCACCTACAAC
AAG
CACACCAAAGTGGCGGTGAAGACAATGAAGCCAGGGAGCATGTCCGTGGAGGCCTTCCTGGCTGAGG
CC
AACCTGATGAAGTCGCTGCAGCATGACAAACTGGTGAAGCTACACGCTGTGGTCTCTCAGGAGCCCAT
C
TTTATTGTCACGGAGTTCATGGCCAAAGGAAGCCTGCTGGACTTTCTCAAGAGTGAAGAAGGCAGCAAG
CAG
CCACTGCCAAAACTCATTGACTTCTCAGCCCAGATCTCAGAAGGCATGGCCTTCATTGAGCAGAGGA
AC
TACATCCACCGAGACCTGAGGGCTGCCAACATCTTAGTCTCTGCATCACTGGTGTGTAAGATTGCTGA
C
TTTGGACTGGCACGAATCATCGAGGACAATGAGTACACAGCTCGGGAAGGAGCCAAGTTCCCCATCAAG
TGG
ACAGCTCCTGAAGCCATCAACTTTGGTTCCTTCACCATCAAGTCAGATGTCTGGTCCTTTGGTATCC
TG
CTGATGGAAATTGTCACCTATGGCCGGATCCCTTACCCAGGTATGTCAAACCCAGAGGTGATTCGGGC
A
CTAGAGCATGGGTACCGTATGCCTCGACCAGATAACTGTCCAGAAGAGCTCTACAATATCATGATCCGC
TGC
TGGAAGAACCGCCCCGAGGAACGGCCCACCTTTGAATACATCCAGAGTGTGCTGGATGACTTCTACA
CG
GCCACTGAGAGCCAGTATCAGCAGCAGCCTTGA


Translation (524 aa):
MGGRSSCEDPGCPRSEGRAPRMGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKLGPNNSNSMPP
G
FVE
GSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLATKKEGYIPSNYVARVNSLETE
E
WFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGDTVKHYKIRTLDSGGFYISP
R
STFSSLQELVLHYK
KGKDGLCQKLSVPCVSPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYN
K
HTKVAVKTMKPGSMSVEAFLAEANLMKSLQHDKLVKLHAVVSQEPIFIVTEFMAK
GSLLDFLKSEEGSK
Q
PLPKLIDFSAQ
ISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
W
TAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYP
GMSNPEVIRALEHGYRMPRPDNCPEELYNIMIR
C
WKNRPEERPTFEYIQSVLDDFYTATESQYQQQP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser